| 1234567891011121314151617181920212223242526272829303132333435363738394041424344454647484950515253545556575859606162636465666768697071727374757677787980818283848586878889909192939495969798991001011021031041051061071081091101111121131141151161171181191201211221231241251261271281291301311321331341351361371381391401411421431441451461471481491501511521531541551561571581591601611621631641651661671681691701711721731741751761771781791801811821831841851861871881891901911921931941951961971981992002012022032042052062072082092102112122132142152162172182192202212222232242252262272282292302312322332342352362372382392402412422432442452462472482492502512522532542552562572582592602612622632642652662672682692702712722732742752762772782792802812822832842852862872882892902912922932942952962972982993003013023033043053063073083093103113123133143153163173183193203213223233243253263273283293303313323333343353363373383393403413423433443453463473483493503513523533543553563573583593603613623633643653663673683693703713723733743753763773783793803813823833843853863873883893903913923933943953963973983994004014024034044054064074084094104114124134144154164174184194204214224234244254264274284294304314324334344354364374384394404414424434444454464474484494504514524534544554564574584594604614624634644654664674684694704714724734744754764774784794804814824834844854864874884894904914924934944954964974984995005015025035045055065075085095105115125135145155165175185195205215225235245255265275285295305315325335345355365375385395405415425435445455465475485495505515525535545555565575585595605615625635645655665675685695705715725735745755765775785795805815825835845855865875885895905915925935945955965975985996006016026036046056066076086096106116126136146156166176186196206216226236246256266276286296306316326336346356366376386396406416426436446456466476486496506516526536546556566576586596606616626636646656666676686696706716726736746756766776786796806816826836846856866876886896906916926936946956966976986997007017027037047057067077087097107117127137147157167177187197207217227237247257267277287297307317327337347357367377387397407417427437447457467477487497507517527537547557567577587597607617627637647657667677687697707717727737747757767777787797807817827837847857867877887897907917927937947957967977987998008018028038048058068078088098108118128138148158168178188198208218228238248258268278288298308318328338348358368378388398408418428438448458468478488498508518528538548558568578588598608618628638648658668678688698708718728738748758768778788798808818828838848858868878888898908918928938948958968978988999009019029039049059069079089099109119129139149159169179189199209219229239249259269279289299309319329339349359369379389399409419429439449459469479489499509519529539549559569579589599609619629639649659669679689699709719729739749759769779789799809819829839849859869879889899909919929939949959969979989991000100110021003100410051006100710081009101010111012101310141015101610171018101910201021102210231024102510261027102810291030103110321033103410351036103710381039104010411042104310441045104610471048104910501051105210531054105510561057105810591060106110621063106410651066106710681069107010711072107310741075107610771078107910801081108210831084108510861087108810891090109110921093109410951096109710981099110011011102110311041105110611071108110911101111111211131114111511161117111811191120112111221123112411251126112711281129113011311132113311341135113611371138113911401141114211431144114511461147114811491150115111521153115411551156115711581159116011611162116311641165116611671168116911701171117211731174117511761177117811791180118111821183118411851186118711881189119011911192119311941195119611971198119912001201120212031204120512061207120812091210121112121213121412151216121712181219122012211222122312241225122612271228122912301231123212331234123512361237123812391240124112421243124412451246124712481249125012511252125312541255125612571258125912601261126212631264126512661267126812691270127112721273127412751276127712781279128012811282128312841285128612871288128912901291129212931294129512961297129812991300130113021303130413051306130713081309131013111312131313141315131613171318131913201321132213231324132513261327132813291330133113321333133413351336133713381339134013411342134313441345134613471348134913501351135213531354135513561357135813591360136113621363136413651366136713681369137013711372137313741375137613771378137913801381138213831384138513861387138813891390139113921393139413951396139713981399140014011402140314041405140614071408140914101411141214131414141514161417141814191420142114221423142414251426142714281429143014311432143314341435143614371438143914401441144214431444144514461447144814491450145114521453145414551456145714581459146014611462146314641465146614671468146914701471147214731474147514761477147814791480148114821483148414851486148714881489149014911492149314941495149614971498149915001501150215031504150515061507150815091510151115121513151415151516151715181519152015211522152315241525152615271528152915301531153215331534153515361537153815391540154115421543154415451546154715481549155015511552155315541555155615571558155915601561156215631564156515661567156815691570157115721573157415751576157715781579158015811582158315841585158615871588158915901591159215931594159515961597159815991600160116021603160416051606160716081609161016111612161316141615161616171618161916201621162216231624162516261627162816291630163116321633163416351636163716381639164016411642164316441645164616471648164916501651165216531654165516561657165816591660166116621663166416651666166716681669167016711672167316741675167616771678167916801681168216831684168516861687168816891690169116921693169416951696169716981699170017011702170317041705170617071708170917101711171217131714171517161717171817191720172117221723172417251726172717281729173017311732173317341735173617371738173917401741174217431744174517461747174817491750175117521753175417551756175717581759176017611762176317641765176617671768176917701771177217731774177517761777177817791780178117821783178417851786178717881789179017911792179317941795179617971798179918001801180218031804180518061807180818091810181118121813181418151816181718181819182018211822182318241825182618271828182918301831183218331834183518361837183818391840184118421843184418451846184718481849185018511852185318541855185618571858185918601861186218631864186518661867186818691870187118721873187418751876187718781879188018811882188318841885188618871888188918901891189218931894189518961897189818991900190119021903190419051906190719081909191019111912191319141915191619171918191919201921192219231924192519261927192819291930193119321933193419351936193719381939194019411942194319441945194619471948194919501951195219531954195519561957195819591960196119621963196419651966196719681969197019711972197319741975197619771978197919801981198219831984198519861987198819891990199119921993199419951996199719981999200020012002200320042005200620072008200920102011201220132014201520162017201820192020202120222023202420252026202720282029203020312032203320342035203620372038203920402041204220432044204520462047204820492050205120522053205420552056205720582059206020612062206320642065206620672068206920702071207220732074207520762077207820792080208120822083208420852086208720882089209020912092209320942095209620972098209921002101210221032104210521062107210821092110211121122113211421152116211721182119212021212122212321242125212621272128212921302131213221332134213521362137213821392140214121422143214421452146214721482149215021512152215321542155215621572158215921602161216221632164216521662167216821692170217121722173217421752176217721782179218021812182218321842185218621872188218921902191219221932194219521962197219821992200220122022203220422052206220722082209221022112212221322142215221622172218221922202221222222232224222522262227222822292230223122322233223422352236223722382239224022412242224322442245224622472248224922502251225222532254225522562257225822592260226122622263226422652266226722682269227022712272227322742275227622772278227922802281228222832284228522862287228822892290229122922293229422952296229722982299230023012302230323042305230623072308230923102311231223132314231523162317231823192320232123222323232423252326232723282329233023312332233323342335233623372338233923402341234223432344234523462347234823492350235123522353235423552356235723582359236023612362236323642365236623672368236923702371237223732374237523762377237823792380238123822383238423852386238723882389239023912392239323942395239623972398239924002401240224032404240524062407240824092410241124122413241424152416241724182419242024212422242324242425242624272428242924302431243224332434243524362437243824392440244124422443244424452446244724482449245024512452245324542455245624572458245924602461246224632464246524662467246824692470247124722473247424752476247724782479248024812482248324842485248624872488248924902491249224932494249524962497249824992500250125022503250425052506250725082509251025112512251325142515251625172518251925202521252225232524252525262527252825292530253125322533253425352536253725382539254025412542254325442545254625472548254925502551255225532554255525562557255825592560256125622563256425652566256725682569257025712572257325742575257625772578257925802581258225832584258525862587258825892590259125922593259425952596259725982599260026012602260326042605260626072608260926102611261226132614261526162617261826192620262126222623262426252626262726282629263026312632263326342635263626372638263926402641264226432644264526462647264826492650265126522653265426552656265726582659266026612662266326642665266626672668266926702671267226732674267526762677267826792680268126822683268426852686268726882689269026912692269326942695269626972698269927002701270227032704270527062707270827092710271127122713271427152716271727182719272027212722272327242725272627272728272927302731273227332734273527362737273827392740274127422743274427452746274727482749275027512752275327542755275627572758275927602761276227632764276527662767276827692770277127722773277427752776277727782779278027812782278327842785278627872788278927902791279227932794279527962797279827992800280128022803280428052806280728082809281028112812281328142815281628172818281928202821282228232824282528262827282828292830283128322833283428352836283728382839284028412842284328442845284628472848284928502851285228532854285528562857285828592860286128622863286428652866286728682869287028712872287328742875287628772878287928802881288228832884288528862887288828892890289128922893289428952896289728982899290029012902290329042905290629072908290929102911291229132914291529162917291829192920292129222923292429252926292729282929293029312932293329342935293629372938293929402941294229432944294529462947294829492950295129522953295429552956295729582959296029612962296329642965296629672968296929702971297229732974297529762977297829792980298129822983298429852986298729882989299029912992299329942995299629972998299930003001300230033004300530063007300830093010301130123013301430153016301730183019302030213022302330243025302630273028302930303031303230333034303530363037303830393040304130423043304430453046304730483049305030513052305330543055305630573058305930603061306230633064306530663067306830693070307130723073307430753076307730783079308030813082308330843085308630873088308930903091309230933094309530963097309830993100310131023103310431053106310731083109311031113112311331143115311631173118311931203121312231233124312531263127312831293130313131323133313431353136313731383139314031413142314331443145314631473148314931503151315231533154315531563157315831593160316131623163316431653166316731683169317031713172317331743175317631773178317931803181318231833184318531863187318831893190319131923193319431953196319731983199320032013202320332043205320632073208320932103211321232133214321532163217321832193220322132223223322432253226322732283229323032313232323332343235323632373238323932403241324232433244324532463247324832493250325132523253325432553256325732583259326032613262326332643265326632673268326932703271327232733274327532763277327832793280328132823283328432853286328732883289329032913292329332943295329632973298329933003301330233033304330533063307330833093310331133123313331433153316331733183319332033213322332333243325332633273328332933303331333233333334333533363337333833393340334133423343334433453346334733483349335033513352335333543355335633573358335933603361336233633364336533663367336833693370337133723373337433753376337733783379338033813382338333843385338633873388338933903391339233933394339533963397339833993400340134023403340434053406340734083409341034113412341334143415341634173418341934203421342234233424342534263427342834293430343134323433343434353436343734383439344034413442344334443445344634473448344934503451345234533454345534563457345834593460346134623463346434653466346734683469347034713472347334743475347634773478347934803481348234833484348534863487348834893490349134923493349434953496349734983499350035013502350335043505350635073508350935103511351235133514351535163517351835193520352135223523352435253526352735283529353035313532353335343535353635373538353935403541354235433544354535463547354835493550355135523553355435553556355735583559356035613562356335643565356635673568356935703571357235733574357535763577357835793580358135823583358435853586358735883589359035913592359335943595359635973598359936003601360236033604360536063607360836093610361136123613361436153616361736183619362036213622362336243625362636273628362936303631363236333634363536363637363836393640364136423643364436453646364736483649365036513652365336543655365636573658365936603661366236633664366536663667366836693670367136723673367436753676367736783679368036813682368336843685368636873688368936903691369236933694369536963697369836993700370137023703370437053706370737083709371037113712371337143715371637173718371937203721372237233724372537263727372837293730373137323733373437353736373737383739374037413742374337443745374637473748374937503751375237533754375537563757375837593760376137623763376437653766376737683769377037713772377337743775377637773778377937803781378237833784378537863787378837893790379137923793379437953796379737983799380038013802380338043805380638073808380938103811381238133814381538163817381838193820382138223823382438253826382738283829383038313832383338343835383638373838383938403841384238433844384538463847384838493850385138523853385438553856385738583859386038613862386338643865386638673868386938703871387238733874387538763877387838793880388138823883388438853886388738883889389038913892389338943895389638973898389939003901390239033904390539063907390839093910391139123913391439153916391739183919392039213922392339243925392639273928392939303931393239333934393539363937393839393940394139423943394439453946394739483949395039513952395339543955395639573958395939603961396239633964396539663967396839693970397139723973397439753976397739783979398039813982398339843985398639873988398939903991399239933994399539963997399839994000400140024003400440054006400740084009401040114012401340144015401640174018401940204021402240234024402540264027402840294030403140324033403440354036403740384039404040414042404340444045404640474048404940504051405240534054405540564057405840594060406140624063406440654066406740684069407040714072407340744075407640774078407940804081408240834084408540864087408840894090409140924093409440954096409740984099410041014102410341044105410641074108410941104111411241134114411541164117411841194120412141224123412441254126412741284129413041314132413341344135413641374138413941404141414241434144414541464147414841494150415141524153415441554156415741584159416041614162416341644165416641674168416941704171417241734174417541764177417841794180418141824183418441854186418741884189419041914192419341944195419641974198419942004201420242034204420542064207420842094210421142124213421442154216421742184219422042214222422342244225422642274228422942304231423242334234423542364237423842394240424142424243424442454246424742484249425042514252425342544255425642574258425942604261426242634264426542664267426842694270427142724273427442754276427742784279428042814282428342844285428642874288428942904291429242934294429542964297429842994300430143024303430443054306430743084309431043114312431343144315431643174318431943204321432243234324432543264327432843294330433143324333433443354336433743384339434043414342434343444345434643474348434943504351435243534354435543564357435843594360436143624363436443654366436743684369437043714372437343744375437643774378437943804381438243834384438543864387438843894390439143924393439443954396439743984399440044014402440344044405440644074408440944104411441244134414441544164417441844194420442144224423442444254426442744284429443044314432443344344435443644374438443944404441444244434444444544464447444844494450445144524453445444554456445744584459446044614462446344644465446644674468446944704471447244734474447544764477447844794480448144824483448444854486448744884489449044914492449344944495449644974498449945004501450245034504450545064507450845094510451145124513451445154516451745184519452045214522452345244525452645274528452945304531453245334534453545364537453845394540454145424543454445454546454745484549455045514552455345544555455645574558455945604561456245634564456545664567456845694570457145724573457445754576457745784579458045814582458345844585458645874588458945904591459245934594459545964597459845994600460146024603460446054606460746084609461046114612461346144615461646174618461946204621462246234624462546264627462846294630463146324633463446354636463746384639464046414642464346444645464646474648464946504651465246534654465546564657465846594660466146624663466446654666466746684669467046714672467346744675467646774678467946804681468246834684468546864687468846894690469146924693469446954696469746984699470047014702470347044705470647074708470947104711471247134714471547164717471847194720472147224723472447254726472747284729473047314732473347344735473647374738473947404741474247434744474547464747474847494750475147524753475447554756475747584759476047614762476347644765476647674768476947704771477247734774477547764777477847794780478147824783478447854786478747884789479047914792479347944795479647974798479948004801480248034804480548064807480848094810481148124813481448154816481748184819482048214822482348244825482648274828482948304831483248334834483548364837483848394840484148424843484448454846484748484849485048514852485348544855485648574858485948604861486248634864486548664867486848694870487148724873487448754876487748784879488048814882488348844885488648874888488948904891489248934894489548964897489848994900490149024903490449054906490749084909491049114912491349144915491649174918491949204921492249234924492549264927492849294930493149324933493449354936493749384939494049414942494349444945494649474948494949504951495249534954495549564957495849594960496149624963496449654966496749684969497049714972497349744975497649774978497949804981498249834984498549864987498849894990499149924993499449954996499749984999500050015002500350045005500650075008500950105011501250135014501550165017501850195020502150225023502450255026502750285029503050315032503350345035503650375038503950405041504250435044504550465047504850495050505150525053505450555056505750585059506050615062506350645065506650675068506950705071507250735074507550765077507850795080508150825083508450855086508750885089509050915092509350945095509650975098509951005101510251035104510551065107510851095110511151125113511451155116511751185119512051215122512351245125512651275128512951305131513251335134513551365137513851395140514151425143514451455146514751485149515051515152515351545155515651575158515951605161516251635164516551665167516851695170517151725173517451755176517751785179518051815182518351845185518651875188518951905191519251935194519551965197519851995200520152025203520452055206520752085209521052115212521352145215521652175218521952205221522252235224522552265227522852295230523152325233523452355236523752385239524052415242524352445245524652475248524952505251525252535254525552565257525852595260526152625263526452655266526752685269527052715272527352745275527652775278527952805281528252835284528552865287528852895290529152925293529452955296529752985299530053015302530353045305530653075308530953105311531253135314531553165317531853195320532153225323532453255326532753285329533053315332533353345335533653375338533953405341534253435344534553465347534853495350535153525353535453555356535753585359536053615362536353645365536653675368536953705371537253735374537553765377537853795380538153825383538453855386538753885389539053915392539353945395539653975398539954005401540254035404540554065407540854095410541154125413541454155416541754185419542054215422542354245425542654275428542954305431543254335434543554365437543854395440544154425443544454455446544754485449545054515452545354545455545654575458545954605461546254635464546554665467546854695470547154725473547454755476547754785479548054815482548354845485548654875488548954905491549254935494549554965497549854995500550155025503550455055506550755085509551055115512551355145515551655175518551955205521552255235524552555265527552855295530553155325533553455355536553755385539554055415542554355445545554655475548554955505551555255535554555555565557555855595560556155625563556455655566556755685569557055715572557355745575557655775578557955805581558255835584558555865587558855895590559155925593559455955596559755985599560056015602560356045605560656075608560956105611561256135614561556165617561856195620562156225623562456255626562756285629563056315632563356345635563656375638563956405641564256435644564556465647564856495650565156525653565456555656565756585659566056615662566356645665566656675668566956705671567256735674567556765677567856795680568156825683568456855686568756885689569056915692569356945695569656975698569957005701570257035704570557065707570857095710571157125713571457155716571757185719572057215722572357245725572657275728572957305731573257335734573557365737573857395740574157425743574457455746574757485749575057515752575357545755575657575758575957605761576257635764576557665767576857695770577157725773577457755776577757785779578057815782578357845785578657875788578957905791579257935794579557965797579857995800580158025803580458055806580758085809581058115812581358145815581658175818581958205821582258235824582558265827582858295830583158325833583458355836583758385839584058415842584358445845584658475848584958505851585258535854585558565857585858595860586158625863586458655866586758685869587058715872587358745875587658775878587958805881588258835884588558865887588858895890589158925893589458955896589758985899590059015902590359045905590659075908590959105911591259135914591559165917591859195920592159225923592459255926592759285929593059315932593359345935593659375938593959405941594259435944594559465947594859495950595159525953595459555956595759585959596059615962596359645965596659675968596959705971597259735974597559765977597859795980598159825983598459855986598759885989599059915992599359945995599659975998599960006001600260036004600560066007600860096010601160126013601460156016601760186019602060216022602360246025602660276028602960306031603260336034603560366037603860396040604160426043604460456046604760486049605060516052605360546055605660576058605960606061606260636064606560666067606860696070607160726073607460756076607760786079608060816082608360846085608660876088608960906091609260936094609560966097609860996100610161026103610461056106610761086109611061116112611361146115611661176118611961206121612261236124612561266127612861296130613161326133613461356136613761386139614061416142614361446145614661476148614961506151615261536154615561566157615861596160616161626163616461656166616761686169617061716172617361746175617661776178617961806181618261836184618561866187618861896190619161926193619461956196619761986199620062016202620362046205620662076208620962106211621262136214621562166217621862196220622162226223622462256226622762286229623062316232623362346235623662376238623962406241624262436244624562466247624862496250625162526253625462556256625762586259626062616262626362646265626662676268626962706271627262736274627562766277627862796280628162826283628462856286628762886289629062916292629362946295629662976298629963006301630263036304630563066307630863096310631163126313631463156316631763186319632063216322632363246325632663276328632963306331633263336334633563366337633863396340634163426343634463456346634763486349635063516352635363546355635663576358635963606361636263636364636563666367636863696370637163726373637463756376637763786379638063816382638363846385638663876388638963906391639263936394639563966397639863996400640164026403640464056406640764086409641064116412641364146415641664176418641964206421642264236424642564266427642864296430643164326433643464356436643764386439644064416442644364446445644664476448644964506451645264536454645564566457645864596460646164626463646464656466646764686469647064716472647364746475647664776478647964806481648264836484648564866487648864896490649164926493649464956496649764986499650065016502650365046505650665076508650965106511651265136514651565166517651865196520652165226523652465256526652765286529653065316532653365346535653665376538653965406541654265436544654565466547654865496550655165526553655465556556655765586559656065616562656365646565656665676568656965706571657265736574657565766577657865796580658165826583658465856586658765886589659065916592659365946595659665976598659966006601660266036604660566066607660866096610661166126613661466156616661766186619662066216622662366246625662666276628662966306631663266336634663566366637663866396640664166426643664466456646664766486649665066516652665366546655665666576658665966606661666266636664666566666667666866696670667166726673667466756676667766786679668066816682668366846685668666876688668966906691669266936694669566966697669866996700670167026703670467056706670767086709671067116712671367146715671667176718671967206721672267236724672567266727672867296730673167326733673467356736673767386739674067416742674367446745674667476748674967506751675267536754675567566757675867596760676167626763676467656766676767686769677067716772677367746775677667776778677967806781678267836784678567866787678867896790679167926793679467956796679767986799680068016802680368046805680668076808680968106811681268136814681568166817681868196820682168226823682468256826682768286829683068316832683368346835683668376838683968406841684268436844684568466847684868496850685168526853685468556856685768586859686068616862686368646865686668676868686968706871687268736874687568766877687868796880688168826883688468856886688768886889689068916892689368946895689668976898689969006901690269036904690569066907690869096910691169126913691469156916691769186919692069216922692369246925692669276928692969306931693269336934693569366937693869396940694169426943694469456946694769486949695069516952695369546955695669576958695969606961696269636964696569666967696869696970697169726973697469756976697769786979698069816982698369846985698669876988698969906991699269936994699569966997699869997000700170027003700470057006700770087009701070117012701370147015701670177018701970207021702270237024702570267027702870297030703170327033703470357036703770387039704070417042704370447045704670477048704970507051705270537054705570567057705870597060706170627063706470657066706770687069707070717072707370747075707670777078707970807081708270837084708570867087708870897090709170927093709470957096709770987099710071017102710371047105710671077108710971107111711271137114711571167117711871197120712171227123712471257126712771287129713071317132713371347135713671377138713971407141714271437144714571467147714871497150715171527153715471557156715771587159716071617162716371647165716671677168716971707171717271737174717571767177717871797180718171827183718471857186718771887189719071917192719371947195719671977198719972007201720272037204720572067207720872097210721172127213721472157216721772187219722072217222722372247225722672277228722972307231723272337234723572367237723872397240724172427243724472457246724772487249725072517252725372547255725672577258725972607261726272637264726572667267726872697270727172727273727472757276727772787279728072817282728372847285728672877288728972907291729272937294729572967297729872997300730173027303730473057306730773087309731073117312731373147315731673177318731973207321732273237324732573267327732873297330733173327333733473357336733773387339734073417342734373447345734673477348734973507351735273537354735573567357735873597360736173627363736473657366736773687369737073717372737373747375737673777378737973807381738273837384738573867387738873897390739173927393739473957396739773987399740074017402740374047405740674077408740974107411741274137414741574167417741874197420742174227423742474257426742774287429743074317432743374347435743674377438743974407441744274437444744574467447744874497450745174527453745474557456745774587459746074617462746374647465746674677468746974707471747274737474747574767477747874797480748174827483748474857486748774887489749074917492749374947495749674977498749975007501750275037504750575067507750875097510751175127513751475157516751775187519752075217522752375247525752675277528752975307531753275337534753575367537753875397540754175427543754475457546754775487549755075517552755375547555755675577558755975607561756275637564756575667567756875697570757175727573757475757576757775787579758075817582758375847585758675877588758975907591759275937594759575967597759875997600760176027603760476057606760776087609761076117612761376147615761676177618761976207621762276237624762576267627762876297630763176327633763476357636763776387639764076417642764376447645764676477648764976507651765276537654765576567657765876597660766176627663766476657666766776687669767076717672767376747675767676777678767976807681768276837684768576867687768876897690769176927693769476957696769776987699770077017702770377047705770677077708770977107711771277137714771577167717771877197720772177227723772477257726772777287729773077317732773377347735773677377738773977407741774277437744774577467747774877497750775177527753775477557756775777587759776077617762776377647765776677677768776977707771777277737774777577767777777877797780778177827783778477857786778777887789779077917792779377947795779677977798779978007801780278037804780578067807780878097810781178127813781478157816781778187819782078217822782378247825782678277828782978307831783278337834783578367837783878397840784178427843784478457846784778487849785078517852785378547855785678577858785978607861786278637864786578667867786878697870787178727873787478757876787778787879788078817882788378847885788678877888788978907891789278937894789578967897789878997900790179027903790479057906790779087909791079117912791379147915791679177918791979207921792279237924792579267927792879297930793179327933793479357936793779387939794079417942794379447945794679477948794979507951795279537954795579567957795879597960796179627963796479657966796779687969797079717972797379747975797679777978797979807981798279837984798579867987798879897990799179927993799479957996799779987999800080018002800380048005800680078008800980108011801280138014801580168017801880198020802180228023802480258026802780288029803080318032803380348035803680378038803980408041804280438044804580468047804880498050805180528053805480558056805780588059806080618062806380648065806680678068806980708071807280738074807580768077807880798080808180828083808480858086808780888089809080918092809380948095809680978098809981008101810281038104810581068107810881098110811181128113811481158116811781188119812081218122812381248125812681278128812981308131813281338134813581368137813881398140814181428143814481458146814781488149815081518152815381548155815681578158815981608161816281638164816581668167816881698170817181728173817481758176817781788179818081818182818381848185818681878188818981908191819281938194819581968197819881998200820182028203820482058206820782088209821082118212821382148215821682178218821982208221822282238224822582268227822882298230823182328233823482358236823782388239824082418242824382448245824682478248824982508251825282538254825582568257825882598260826182628263826482658266826782688269827082718272827382748275827682778278827982808281828282838284828582868287828882898290829182928293829482958296829782988299830083018302830383048305830683078308830983108311831283138314831583168317831883198320832183228323832483258326832783288329833083318332833383348335833683378338833983408341834283438344834583468347834883498350835183528353835483558356835783588359836083618362836383648365836683678368836983708371837283738374837583768377837883798380838183828383838483858386838783888389839083918392839383948395839683978398839984008401840284038404840584068407840884098410841184128413841484158416841784188419842084218422842384248425842684278428842984308431843284338434843584368437843884398440844184428443844484458446844784488449845084518452845384548455845684578458845984608461846284638464846584668467846884698470847184728473847484758476847784788479848084818482848384848485848684878488848984908491849284938494849584968497849884998500850185028503850485058506850785088509851085118512851385148515851685178518851985208521852285238524852585268527852885298530853185328533853485358536853785388539854085418542854385448545854685478548854985508551855285538554855585568557855885598560856185628563856485658566856785688569857085718572857385748575857685778578857985808581858285838584858585868587858885898590859185928593859485958596859785988599860086018602860386048605860686078608860986108611861286138614861586168617861886198620862186228623862486258626862786288629863086318632863386348635863686378638863986408641864286438644864586468647864886498650865186528653865486558656865786588659866086618662866386648665866686678668866986708671867286738674867586768677867886798680868186828683868486858686868786888689869086918692869386948695869686978698869987008701870287038704870587068707870887098710871187128713871487158716871787188719872087218722872387248725872687278728872987308731873287338734873587368737873887398740874187428743874487458746874787488749875087518752875387548755875687578758875987608761876287638764876587668767876887698770877187728773877487758776877787788779878087818782878387848785878687878788878987908791879287938794879587968797879887998800880188028803880488058806880788088809881088118812881388148815881688178818881988208821882288238824882588268827882888298830883188328833883488358836883788388839884088418842884388448845884688478848884988508851885288538854885588568857885888598860886188628863886488658866886788688869887088718872887388748875887688778878887988808881888288838884888588868887888888898890889188928893889488958896889788988899890089018902890389048905890689078908890989108911891289138914891589168917891889198920892189228923892489258926892789288929893089318932893389348935893689378938893989408941894289438944894589468947894889498950895189528953895489558956895789588959896089618962896389648965896689678968896989708971897289738974897589768977897889798980898189828983898489858986898789888989899089918992899389948995899689978998899990009001900290039004900590069007900890099010901190129013901490159016901790189019902090219022902390249025902690279028902990309031903290339034903590369037903890399040904190429043904490459046904790489049905090519052905390549055905690579058905990609061906290639064906590669067906890699070907190729073907490759076907790789079908090819082908390849085908690879088908990909091909290939094909590969097909890999100910191029103910491059106910791089109911091119112911391149115911691179118911991209121912291239124912591269127912891299130913191329133913491359136913791389139914091419142914391449145914691479148914991509151915291539154915591569157915891599160916191629163916491659166916791689169917091719172917391749175917691779178917991809181918291839184918591869187918891899190919191929193919491959196919791989199920092019202920392049205920692079208920992109211921292139214921592169217921892199220922192229223922492259226922792289229923092319232923392349235923692379238923992409241924292439244924592469247924892499250925192529253925492559256925792589259926092619262926392649265926692679268926992709271927292739274927592769277927892799280928192829283928492859286928792889289929092919292929392949295929692979298929993009301930293039304930593069307930893099310931193129313931493159316931793189319932093219322932393249325932693279328932993309331933293339334933593369337933893399340934193429343934493459346934793489349935093519352935393549355935693579358935993609361936293639364936593669367936893699370937193729373937493759376937793789379938093819382938393849385938693879388938993909391939293939394939593969397939893999400940194029403940494059406940794089409941094119412941394149415941694179418941994209421942294239424942594269427942894299430943194329433943494359436943794389439944094419442944394449445944694479448944994509451945294539454945594569457945894599460946194629463946494659466946794689469947094719472947394749475947694779478947994809481948294839484948594869487948894899490949194929493949494959496949794989499950095019502950395049505950695079508950995109511951295139514951595169517951895199520952195229523952495259526952795289529953095319532953395349535953695379538953995409541954295439544954595469547954895499550955195529553955495559556955795589559956095619562956395649565956695679568956995709571957295739574957595769577957895799580958195829583958495859586958795889589959095919592959395949595959695979598959996009601960296039604960596069607960896099610961196129613961496159616961796189619962096219622962396249625962696279628962996309631963296339634963596369637963896399640964196429643964496459646964796489649965096519652965396549655965696579658965996609661966296639664966596669667966896699670967196729673967496759676967796789679968096819682968396849685968696879688968996909691969296939694969596969697969896999700970197029703970497059706970797089709971097119712971397149715971697179718971997209721972297239724972597269727972897299730973197329733973497359736973797389739974097419742974397449745974697479748974997509751975297539754975597569757975897599760976197629763976497659766976797689769977097719772977397749775977697779778977997809781978297839784978597869787978897899790979197929793979497959796979797989799980098019802980398049805980698079808980998109811981298139814981598169817981898199820982198229823982498259826982798289829983098319832983398349835983698379838983998409841984298439844984598469847984898499850985198529853985498559856985798589859986098619862986398649865986698679868986998709871987298739874987598769877987898799880988198829883988498859886988798889889989098919892989398949895989698979898989999009901990299039904990599069907990899099910991199129913991499159916991799189919992099219922992399249925992699279928992999309931993299339934993599369937993899399940994199429943994499459946994799489949995099519952995399549955995699579958995999609961996299639964996599669967996899699970997199729973997499759976997799789979998099819982998399849985998699879988998999909991999299939994999599969997999899991000010001100021000310004100051000610007100081000910010100111001210013100141001510016100171001810019100201002110022100231002410025100261002710028100291003010031100321003310034100351003610037100381003910040100411004210043100441004510046100471004810049100501005110052100531005410055100561005710058100591006010061100621006310064100651006610067100681006910070100711007210073100741007510076100771007810079100801008110082100831008410085100861008710088100891009010091100921009310094100951009610097100981009910100101011010210103101041010510106101071010810109101101011110112101131011410115101161011710118101191012010121101221012310124101251012610127101281012910130101311013210133101341013510136101371013810139101401014110142101431014410145101461014710148101491015010151101521015310154101551015610157101581015910160101611016210163101641016510166101671016810169101701017110172101731017410175101761017710178101791018010181101821018310184101851018610187101881018910190101911019210193101941019510196101971019810199102001020110202102031020410205102061020710208102091021010211102121021310214102151021610217102181021910220102211022210223102241022510226102271022810229102301023110232102331023410235102361023710238102391024010241102421024310244102451024610247102481024910250102511025210253102541025510256102571025810259102601026110262102631026410265102661026710268102691027010271102721027310274102751027610277102781027910280102811028210283102841028510286102871028810289102901029110292102931029410295102961029710298102991030010301103021030310304103051030610307103081030910310103111031210313103141031510316103171031810319103201032110322103231032410325103261032710328103291033010331103321033310334103351033610337103381033910340103411034210343103441034510346103471034810349103501035110352103531035410355103561035710358103591036010361103621036310364103651036610367103681036910370103711037210373103741037510376103771037810379103801038110382103831038410385103861038710388103891039010391103921039310394103951039610397103981039910400104011040210403104041040510406104071040810409104101041110412104131041410415104161041710418104191042010421104221042310424104251042610427104281042910430104311043210433104341043510436104371043810439104401044110442104431044410445104461044710448104491045010451104521045310454104551045610457104581045910460104611046210463104641046510466104671046810469104701047110472104731047410475104761047710478104791048010481104821048310484104851048610487104881048910490104911049210493104941049510496104971049810499105001050110502105031050410505105061050710508105091051010511105121051310514105151051610517105181051910520105211052210523105241052510526105271052810529105301053110532105331053410535105361053710538105391054010541105421054310544105451054610547105481054910550105511055210553105541055510556105571055810559105601056110562105631056410565105661056710568105691057010571105721057310574105751057610577105781057910580105811058210583105841058510586105871058810589105901059110592105931059410595105961059710598105991060010601106021060310604106051060610607106081060910610106111061210613106141061510616106171061810619106201062110622106231062410625106261062710628106291063010631106321063310634106351063610637106381063910640106411064210643106441064510646106471064810649106501065110652106531065410655106561065710658106591066010661106621066310664106651066610667106681066910670106711067210673106741067510676106771067810679106801068110682106831068410685106861068710688106891069010691106921069310694106951069610697106981069910700107011070210703107041070510706107071070810709107101071110712107131071410715107161071710718107191072010721107221072310724107251072610727107281072910730107311073210733107341073510736107371073810739107401074110742107431074410745107461074710748107491075010751107521075310754107551075610757107581075910760107611076210763107641076510766107671076810769107701077110772107731077410775107761077710778107791078010781107821078310784107851078610787107881078910790107911079210793107941079510796107971079810799108001080110802108031080410805108061080710808108091081010811108121081310814108151081610817108181081910820108211082210823108241082510826108271082810829108301083110832108331083410835108361083710838108391084010841108421084310844108451084610847108481084910850108511085210853108541085510856108571085810859108601086110862108631086410865108661086710868108691087010871108721087310874108751087610877108781087910880108811088210883108841088510886108871088810889108901089110892108931089410895108961089710898108991090010901109021090310904109051090610907109081090910910109111091210913109141091510916109171091810919109201092110922109231092410925109261092710928109291093010931109321093310934109351093610937109381093910940109411094210943109441094510946109471094810949109501095110952109531095410955109561095710958109591096010961109621096310964109651096610967109681096910970109711097210973109741097510976109771097810979109801098110982109831098410985109861098710988109891099010991109921099310994109951099610997109981099911000110011100211003110041100511006110071100811009110101101111012110131101411015110161101711018110191102011021110221102311024110251102611027110281102911030110311103211033110341103511036110371103811039110401104111042110431104411045110461104711048110491105011051110521105311054110551105611057110581105911060110611106211063110641106511066110671106811069110701107111072110731107411075110761107711078110791108011081110821108311084110851108611087110881108911090110911109211093110941109511096110971109811099111001110111102111031110411105111061110711108111091111011111111121111311114111151111611117111181111911120111211112211123111241112511126111271112811129111301113111132111331113411135111361113711138111391114011141111421114311144111451114611147111481114911150111511115211153111541115511156111571115811159111601116111162111631116411165111661116711168111691117011171111721117311174111751117611177111781117911180111811118211183111841118511186111871118811189111901119111192111931119411195111961119711198111991120011201112021120311204112051120611207112081120911210112111121211213112141121511216112171121811219112201122111222112231122411225112261122711228112291123011231112321123311234112351123611237112381123911240112411124211243112441124511246112471124811249112501125111252112531125411255112561125711258112591126011261112621126311264112651126611267112681126911270112711127211273112741127511276112771127811279112801128111282112831128411285112861128711288112891129011291112921129311294112951129611297112981129911300113011130211303113041130511306113071130811309113101131111312113131131411315113161131711318113191132011321113221132311324113251132611327113281132911330113311133211333113341133511336113371133811339113401134111342113431134411345113461134711348113491135011351113521135311354113551135611357113581135911360113611136211363113641136511366113671136811369113701137111372113731137411375113761137711378113791138011381113821138311384113851138611387113881138911390113911139211393113941139511396113971139811399114001140111402114031140411405114061140711408114091141011411114121141311414114151141611417114181141911420114211142211423114241142511426114271142811429114301143111432114331143411435114361143711438114391144011441114421144311444114451144611447114481144911450114511145211453114541145511456114571145811459114601146111462114631146411465114661146711468114691147011471114721147311474114751147611477114781147911480114811148211483114841148511486114871148811489114901149111492114931149411495114961149711498114991150011501115021150311504115051150611507115081150911510115111151211513115141151511516115171151811519115201152111522115231152411525115261152711528115291153011531115321153311534115351153611537115381153911540115411154211543115441154511546115471154811549115501155111552115531155411555115561155711558115591156011561115621156311564115651156611567115681156911570115711157211573115741157511576115771157811579115801158111582115831158411585115861158711588115891159011591115921159311594115951159611597115981159911600116011160211603116041160511606116071160811609116101161111612116131161411615116161161711618116191162011621116221162311624116251162611627116281162911630116311163211633116341163511636116371163811639116401164111642116431164411645116461164711648116491165011651116521165311654116551165611657116581165911660116611166211663116641166511666116671166811669116701167111672116731167411675116761167711678116791168011681116821168311684116851168611687116881168911690116911169211693116941169511696116971169811699117001170111702117031170411705117061170711708117091171011711117121171311714117151171611717117181171911720117211172211723117241172511726117271172811729117301173111732117331173411735117361173711738117391174011741117421174311744117451174611747117481174911750117511175211753117541175511756117571175811759117601176111762117631176411765117661176711768117691177011771117721177311774117751177611777117781177911780117811178211783117841178511786117871178811789117901179111792117931179411795117961179711798117991180011801118021180311804118051180611807118081180911810118111181211813118141181511816118171181811819118201182111822118231182411825118261182711828118291183011831118321183311834118351183611837118381183911840118411184211843118441184511846118471184811849118501185111852118531185411855118561185711858118591186011861118621186311864118651186611867118681186911870118711187211873118741187511876118771187811879118801188111882118831188411885118861188711888118891189011891118921189311894118951189611897118981189911900119011190211903119041190511906119071190811909119101191111912119131191411915119161191711918119191192011921119221192311924119251192611927119281192911930119311193211933119341193511936119371193811939119401194111942119431194411945119461194711948119491195011951119521195311954119551195611957119581195911960119611196211963119641196511966119671196811969119701197111972119731197411975119761197711978119791198011981119821198311984119851198611987119881198911990119911199211993119941199511996119971199811999120001200112002120031200412005120061200712008120091201012011120121201312014120151201612017120181201912020120211202212023120241202512026120271202812029120301203112032120331203412035120361203712038120391204012041120421204312044120451204612047120481204912050120511205212053120541205512056120571205812059120601206112062120631206412065120661206712068120691207012071120721207312074120751207612077120781207912080120811208212083120841208512086120871208812089120901209112092120931209412095120961209712098120991210012101121021210312104121051210612107121081210912110121111211212113121141211512116121171211812119121201212112122121231212412125121261212712128121291213012131121321213312134121351213612137121381213912140121411214212143121441214512146121471214812149121501215112152121531215412155121561215712158121591216012161121621216312164121651216612167121681216912170121711217212173121741217512176121771217812179121801218112182121831218412185121861218712188121891219012191121921219312194121951219612197121981219912200122011220212203122041220512206122071220812209122101221112212122131221412215122161221712218122191222012221122221222312224122251222612227122281222912230122311223212233122341223512236122371223812239122401224112242122431224412245122461224712248122491225012251122521225312254122551225612257122581225912260122611226212263122641226512266122671226812269122701227112272122731227412275122761227712278122791228012281122821228312284122851228612287122881228912290122911229212293122941229512296122971229812299123001230112302123031230412305123061230712308123091231012311123121231312314123151231612317123181231912320123211232212323123241232512326123271232812329123301233112332123331233412335123361233712338123391234012341123421234312344123451234612347123481234912350123511235212353123541235512356123571235812359123601236112362123631236412365123661236712368123691237012371123721237312374123751237612377123781237912380123811238212383123841238512386123871238812389123901239112392123931239412395123961239712398123991240012401124021240312404124051240612407124081240912410124111241212413124141241512416124171241812419124201242112422124231242412425124261242712428124291243012431124321243312434124351243612437124381243912440124411244212443124441244512446124471244812449124501245112452124531245412455124561245712458124591246012461124621246312464124651246612467124681246912470124711247212473124741247512476124771247812479124801248112482124831248412485124861248712488124891249012491124921249312494124951249612497124981249912500125011250212503125041250512506125071250812509125101251112512125131251412515125161251712518125191252012521125221252312524125251252612527125281252912530125311253212533125341253512536125371253812539125401254112542125431254412545125461254712548125491255012551125521255312554125551255612557125581255912560125611256212563125641256512566125671256812569125701257112572125731257412575125761257712578125791258012581125821258312584125851258612587125881258912590125911259212593125941259512596125971259812599126001260112602126031260412605126061260712608126091261012611126121261312614126151261612617126181261912620126211262212623126241262512626126271262812629126301263112632126331263412635126361263712638126391264012641126421264312644126451264612647126481264912650126511265212653126541265512656126571265812659126601266112662126631266412665126661266712668126691267012671126721267312674126751267612677126781267912680126811268212683126841268512686126871268812689126901269112692126931269412695126961269712698126991270012701127021270312704127051270612707127081270912710127111271212713127141271512716127171271812719127201272112722127231272412725127261272712728127291273012731127321273312734127351273612737127381273912740127411274212743127441274512746127471274812749127501275112752127531275412755127561275712758127591276012761127621276312764127651276612767127681276912770127711277212773127741277512776127771277812779127801278112782127831278412785127861278712788127891279012791127921279312794127951279612797127981279912800128011280212803128041280512806128071280812809128101281112812128131281412815128161281712818128191282012821128221282312824128251282612827128281282912830128311283212833128341283512836128371283812839128401284112842128431284412845128461284712848128491285012851128521285312854128551285612857128581285912860128611286212863128641286512866128671286812869128701287112872128731287412875128761287712878128791288012881128821288312884128851288612887128881288912890128911289212893128941289512896128971289812899129001290112902129031290412905129061290712908129091291012911129121291312914129151291612917129181291912920129211292212923129241292512926129271292812929129301293112932129331293412935129361293712938129391294012941129421294312944129451294612947129481294912950129511295212953129541295512956129571295812959129601296112962129631296412965129661296712968129691297012971129721297312974129751297612977129781297912980129811298212983129841298512986129871298812989129901299112992129931299412995129961299712998129991300013001130021300313004130051300613007130081300913010130111301213013130141301513016130171301813019130201302113022130231302413025130261302713028130291303013031130321303313034130351303613037130381303913040130411304213043130441304513046130471304813049130501305113052130531305413055130561305713058130591306013061130621306313064130651306613067130681306913070130711307213073130741307513076130771307813079130801308113082130831308413085130861308713088130891309013091130921309313094130951309613097130981309913100131011310213103131041310513106131071310813109131101311113112131131311413115131161311713118131191312013121131221312313124131251312613127131281312913130131311313213133131341313513136131371313813139131401314113142131431314413145131461314713148131491315013151131521315313154131551315613157131581315913160131611316213163131641316513166131671316813169131701317113172131731317413175131761317713178131791318013181131821318313184131851318613187131881318913190131911319213193131941319513196131971319813199132001320113202132031320413205132061320713208132091321013211132121321313214132151321613217132181321913220132211322213223132241322513226132271322813229132301323113232132331323413235132361323713238132391324013241132421324313244132451324613247132481324913250132511325213253132541325513256132571325813259132601326113262132631326413265132661326713268132691327013271132721327313274132751327613277132781327913280132811328213283132841328513286132871328813289132901329113292132931329413295132961329713298132991330013301133021330313304133051330613307133081330913310133111331213313133141331513316133171331813319133201332113322133231332413325133261332713328133291333013331133321333313334133351333613337133381333913340133411334213343133441334513346133471334813349133501335113352133531335413355133561335713358133591336013361133621336313364133651336613367133681336913370133711337213373133741337513376133771337813379133801338113382133831338413385133861338713388133891339013391133921339313394133951339613397133981339913400134011340213403134041340513406134071340813409134101341113412134131341413415134161341713418134191342013421134221342313424134251342613427134281342913430134311343213433134341343513436134371343813439134401344113442134431344413445134461344713448134491345013451134521345313454134551345613457134581345913460134611346213463134641346513466134671346813469134701347113472134731347413475134761347713478134791348013481134821348313484134851348613487134881348913490134911349213493134941349513496134971349813499135001350113502135031350413505135061350713508135091351013511135121351313514135151351613517135181351913520135211352213523135241352513526135271352813529135301353113532135331353413535135361353713538135391354013541135421354313544135451354613547135481354913550135511355213553135541355513556135571355813559135601356113562135631356413565135661356713568135691357013571135721357313574135751357613577135781357913580135811358213583135841358513586135871358813589135901359113592135931359413595135961359713598135991360013601136021360313604136051360613607136081360913610136111361213613136141361513616136171361813619136201362113622136231362413625136261362713628136291363013631136321363313634136351363613637136381363913640136411364213643136441364513646136471364813649136501365113652136531365413655136561365713658136591366013661136621366313664136651366613667136681366913670136711367213673136741367513676136771367813679136801368113682136831368413685136861368713688136891369013691136921369313694136951369613697136981369913700137011370213703137041370513706137071370813709137101371113712137131371413715137161371713718137191372013721137221372313724137251372613727137281372913730137311373213733137341373513736137371373813739137401374113742137431374413745137461374713748137491375013751137521375313754137551375613757137581375913760137611376213763137641376513766137671376813769137701377113772137731377413775137761377713778137791378013781137821378313784137851378613787137881378913790137911379213793137941379513796137971379813799138001380113802138031380413805138061380713808138091381013811138121381313814138151381613817138181381913820138211382213823138241382513826138271382813829138301383113832138331383413835138361383713838138391384013841138421384313844138451384613847138481384913850138511385213853138541385513856138571385813859138601386113862138631386413865138661386713868138691387013871138721387313874138751387613877138781387913880138811388213883138841388513886138871388813889138901389113892138931389413895138961389713898138991390013901139021390313904139051390613907139081390913910139111391213913139141391513916139171391813919139201392113922139231392413925139261392713928139291393013931139321393313934139351393613937139381393913940139411394213943139441394513946139471394813949139501395113952139531395413955139561395713958139591396013961139621396313964139651396613967139681396913970139711397213973139741397513976139771397813979139801398113982139831398413985139861398713988139891399013991139921399313994139951399613997139981399914000140011400214003140041400514006140071400814009140101401114012140131401414015140161401714018140191402014021140221402314024140251402614027140281402914030140311403214033140341403514036140371403814039140401404114042140431404414045140461404714048140491405014051140521405314054140551405614057140581405914060140611406214063140641406514066140671406814069140701407114072140731407414075140761407714078140791408014081140821408314084140851408614087140881408914090140911409214093140941409514096140971409814099141001410114102141031410414105141061410714108141091411014111141121411314114141151411614117141181411914120141211412214123141241412514126141271412814129141301413114132141331413414135141361413714138141391414014141141421414314144141451414614147141481414914150141511415214153141541415514156141571415814159141601416114162141631416414165141661416714168141691417014171141721417314174141751417614177141781417914180141811418214183141841418514186141871418814189141901419114192141931419414195141961419714198141991420014201142021420314204142051420614207142081420914210142111421214213142141421514216142171421814219142201422114222142231422414225142261422714228142291423014231142321423314234142351423614237142381423914240142411424214243142441424514246142471424814249142501425114252142531425414255142561425714258142591426014261142621426314264142651426614267142681426914270142711427214273142741427514276142771427814279142801428114282142831428414285142861428714288142891429014291142921429314294142951429614297142981429914300143011430214303143041430514306143071430814309143101431114312143131431414315143161431714318143191432014321143221432314324143251432614327143281432914330143311433214333143341433514336143371433814339143401434114342143431434414345143461434714348143491435014351143521435314354143551435614357143581435914360143611436214363143641436514366143671436814369143701437114372143731437414375143761437714378143791438014381143821438314384143851438614387143881438914390143911439214393143941439514396143971439814399144001440114402144031440414405144061440714408144091441014411144121441314414144151441614417144181441914420144211442214423144241442514426144271442814429144301443114432144331443414435144361443714438144391444014441144421444314444144451444614447144481444914450144511445214453144541445514456144571445814459144601446114462144631446414465144661446714468144691447014471144721447314474144751447614477144781447914480144811448214483144841448514486144871448814489144901449114492144931449414495144961449714498144991450014501145021450314504145051450614507145081450914510145111451214513145141451514516145171451814519145201452114522145231452414525145261452714528145291453014531145321453314534145351453614537145381453914540145411454214543145441454514546145471454814549145501455114552145531455414555145561455714558145591456014561145621456314564145651456614567145681456914570145711457214573145741457514576145771457814579145801458114582145831458414585145861458714588145891459014591145921459314594145951459614597145981459914600146011460214603146041460514606146071460814609146101461114612146131461414615146161461714618146191462014621146221462314624146251462614627146281462914630146311463214633146341463514636146371463814639146401464114642146431464414645146461464714648146491465014651146521465314654146551465614657146581465914660146611466214663146641466514666146671466814669146701467114672146731467414675146761467714678146791468014681146821468314684146851468614687146881468914690146911469214693146941469514696146971469814699147001470114702147031470414705147061470714708147091471014711147121471314714147151471614717147181471914720147211472214723147241472514726147271472814729147301473114732147331473414735147361473714738147391474014741147421474314744147451474614747147481474914750147511475214753147541475514756147571475814759147601476114762147631476414765147661476714768147691477014771147721477314774147751477614777147781477914780147811478214783147841478514786147871478814789147901479114792147931479414795147961479714798147991480014801148021480314804148051480614807148081480914810148111481214813148141481514816148171481814819148201482114822148231482414825148261482714828148291483014831148321483314834148351483614837148381483914840148411484214843148441484514846148471484814849148501485114852148531485414855148561485714858148591486014861148621486314864148651486614867148681486914870148711487214873148741487514876148771487814879148801488114882148831488414885148861488714888148891489014891148921489314894148951489614897148981489914900149011490214903149041490514906149071490814909149101491114912149131491414915149161491714918149191492014921149221492314924149251492614927149281492914930149311493214933149341493514936149371493814939149401494114942149431494414945149461494714948149491495014951149521495314954149551495614957149581495914960149611496214963149641496514966149671496814969149701497114972149731497414975149761497714978149791498014981149821498314984149851498614987149881498914990149911499214993149941499514996149971499814999150001500115002150031500415005150061500715008150091501015011150121501315014150151501615017150181501915020150211502215023150241502515026150271502815029150301503115032150331503415035150361503715038150391504015041150421504315044150451504615047150481504915050150511505215053150541505515056150571505815059150601506115062150631506415065150661506715068150691507015071150721507315074150751507615077150781507915080150811508215083150841508515086150871508815089150901509115092150931509415095150961509715098150991510015101151021510315104151051510615107151081510915110151111511215113151141511515116151171511815119151201512115122151231512415125151261512715128151291513015131151321513315134151351513615137151381513915140151411514215143151441514515146151471514815149151501515115152151531515415155151561515715158151591516015161151621516315164151651516615167151681516915170151711517215173151741517515176151771517815179151801518115182151831518415185151861518715188151891519015191151921519315194151951519615197151981519915200152011520215203152041520515206152071520815209152101521115212152131521415215152161521715218152191522015221152221522315224152251522615227152281522915230152311523215233152341523515236152371523815239152401524115242152431524415245152461524715248152491525015251152521525315254152551525615257152581525915260152611526215263152641526515266152671526815269152701527115272152731527415275152761527715278152791528015281152821528315284152851528615287152881528915290152911529215293152941529515296152971529815299153001530115302153031530415305153061530715308153091531015311153121531315314153151531615317153181531915320153211532215323153241532515326153271532815329153301533115332153331533415335153361533715338153391534015341153421534315344153451534615347153481534915350153511535215353153541535515356153571535815359153601536115362153631536415365153661536715368153691537015371153721537315374153751537615377153781537915380153811538215383153841538515386153871538815389153901539115392153931539415395153961539715398153991540015401154021540315404154051540615407154081540915410154111541215413154141541515416154171541815419154201542115422154231542415425154261542715428154291543015431154321543315434154351543615437154381543915440154411544215443154441544515446154471544815449154501545115452154531545415455154561545715458154591546015461154621546315464154651546615467154681546915470154711547215473154741547515476154771547815479154801548115482154831548415485154861548715488154891549015491154921549315494154951549615497154981549915500155011550215503155041550515506155071550815509155101551115512155131551415515155161551715518155191552015521155221552315524155251552615527155281552915530155311553215533155341553515536155371553815539155401554115542155431554415545155461554715548155491555015551155521555315554155551555615557155581555915560155611556215563155641556515566155671556815569155701557115572155731557415575155761557715578155791558015581155821558315584155851558615587155881558915590155911559215593155941559515596155971559815599156001560115602156031560415605156061560715608156091561015611156121561315614156151561615617156181561915620156211562215623156241562515626156271562815629156301563115632156331563415635156361563715638156391564015641156421564315644156451564615647156481564915650156511565215653156541565515656156571565815659156601566115662156631566415665156661566715668156691567015671156721567315674156751567615677156781567915680156811568215683156841568515686156871568815689156901569115692156931569415695156961569715698156991570015701157021570315704157051570615707157081570915710157111571215713157141571515716157171571815719157201572115722157231572415725157261572715728157291573015731157321573315734157351573615737157381573915740157411574215743157441574515746157471574815749157501575115752157531575415755157561575715758157591576015761157621576315764157651576615767157681576915770157711577215773157741577515776157771577815779157801578115782157831578415785157861578715788157891579015791157921579315794157951579615797157981579915800158011580215803158041580515806158071580815809158101581115812158131581415815158161581715818158191582015821158221582315824158251582615827158281582915830158311583215833158341583515836158371583815839158401584115842158431584415845158461584715848158491585015851158521585315854158551585615857158581585915860158611586215863158641586515866158671586815869158701587115872158731587415875158761587715878158791588015881158821588315884158851588615887158881588915890158911589215893158941589515896158971589815899159001590115902159031590415905159061590715908159091591015911159121591315914159151591615917159181591915920159211592215923159241592515926159271592815929159301593115932159331593415935159361593715938159391594015941159421594315944159451594615947159481594915950159511595215953159541595515956159571595815959159601596115962159631596415965159661596715968159691597015971159721597315974159751597615977159781597915980159811598215983159841598515986159871598815989159901599115992159931599415995159961599715998159991600016001160021600316004160051600616007160081600916010160111601216013160141601516016160171601816019160201602116022160231602416025160261602716028160291603016031160321603316034160351603616037160381603916040160411604216043160441604516046160471604816049160501605116052160531605416055160561605716058160591606016061160621606316064160651606616067160681606916070160711607216073160741607516076160771607816079160801608116082160831608416085160861608716088160891609016091160921609316094160951609616097160981609916100161011610216103161041610516106161071610816109161101611116112161131611416115161161611716118161191612016121161221612316124161251612616127161281612916130161311613216133161341613516136161371613816139161401614116142161431614416145161461614716148161491615016151161521615316154161551615616157161581615916160161611616216163161641616516166161671616816169161701617116172161731617416175161761617716178161791618016181161821618316184161851618616187161881618916190161911619216193161941619516196161971619816199162001620116202162031620416205162061620716208162091621016211162121621316214162151621616217162181621916220162211622216223162241622516226162271622816229162301623116232162331623416235162361623716238162391624016241162421624316244162451624616247162481624916250162511625216253162541625516256162571625816259162601626116262162631626416265162661626716268162691627016271162721627316274162751627616277162781627916280162811628216283162841628516286162871628816289162901629116292162931629416295162961629716298162991630016301163021630316304163051630616307163081630916310163111631216313163141631516316163171631816319163201632116322163231632416325163261632716328163291633016331163321633316334163351633616337163381633916340163411634216343163441634516346163471634816349163501635116352163531635416355163561635716358163591636016361163621636316364163651636616367163681636916370163711637216373163741637516376163771637816379163801638116382163831638416385163861638716388163891639016391163921639316394163951639616397163981639916400164011640216403164041640516406164071640816409164101641116412164131641416415164161641716418164191642016421164221642316424164251642616427164281642916430164311643216433164341643516436164371643816439164401644116442164431644416445164461644716448164491645016451164521645316454164551645616457164581645916460164611646216463164641646516466164671646816469164701647116472164731647416475164761647716478164791648016481164821648316484164851648616487164881648916490164911649216493164941649516496164971649816499165001650116502165031650416505165061650716508165091651016511165121651316514165151651616517165181651916520165211652216523165241652516526165271652816529165301653116532165331653416535165361653716538165391654016541165421654316544165451654616547165481654916550165511655216553165541655516556165571655816559165601656116562165631656416565165661656716568165691657016571165721657316574165751657616577165781657916580165811658216583165841658516586165871658816589165901659116592165931659416595165961659716598165991660016601166021660316604166051660616607166081660916610166111661216613166141661516616166171661816619166201662116622166231662416625166261662716628166291663016631166321663316634166351663616637166381663916640166411664216643166441664516646166471664816649166501665116652166531665416655166561665716658166591666016661166621666316664166651666616667166681666916670166711667216673166741667516676166771667816679166801668116682166831668416685166861668716688166891669016691166921669316694166951669616697166981669916700167011670216703167041670516706167071670816709167101671116712167131671416715167161671716718167191672016721167221672316724167251672616727167281672916730167311673216733167341673516736167371673816739167401674116742167431674416745167461674716748167491675016751167521675316754167551675616757167581675916760167611676216763167641676516766167671676816769167701677116772167731677416775167761677716778167791678016781167821678316784167851678616787167881678916790167911679216793167941679516796167971679816799168001680116802168031680416805168061680716808168091681016811168121681316814168151681616817168181681916820168211682216823168241682516826168271682816829168301683116832168331683416835168361683716838168391684016841168421684316844168451684616847168481684916850168511685216853168541685516856168571685816859168601686116862168631686416865168661686716868168691687016871168721687316874168751687616877168781687916880168811688216883168841688516886168871688816889168901689116892168931689416895168961689716898168991690016901169021690316904169051690616907169081690916910169111691216913169141691516916169171691816919169201692116922169231692416925169261692716928169291693016931169321693316934169351693616937169381693916940169411694216943169441694516946169471694816949169501695116952169531695416955169561695716958169591696016961169621696316964169651696616967169681696916970169711697216973169741697516976169771697816979169801698116982169831698416985169861698716988169891699016991169921699316994169951699616997169981699917000170011700217003170041700517006170071700817009170101701117012170131701417015170161701717018170191702017021170221702317024170251702617027170281702917030170311703217033170341703517036170371703817039170401704117042170431704417045170461704717048170491705017051170521705317054170551705617057170581705917060170611706217063170641706517066170671706817069170701707117072170731707417075170761707717078170791708017081170821708317084170851708617087170881708917090170911709217093170941709517096170971709817099171001710117102171031710417105171061710717108171091711017111171121711317114171151711617117171181711917120171211712217123171241712517126171271712817129171301713117132171331713417135171361713717138171391714017141171421714317144171451714617147171481714917150171511715217153171541715517156171571715817159171601716117162171631716417165171661716717168171691717017171171721717317174171751717617177171781717917180171811718217183171841718517186171871718817189171901719117192171931719417195171961719717198171991720017201172021720317204172051720617207172081720917210172111721217213172141721517216172171721817219172201722117222172231722417225172261722717228172291723017231172321723317234172351723617237172381723917240172411724217243172441724517246172471724817249172501725117252172531725417255172561725717258172591726017261172621726317264172651726617267172681726917270172711727217273172741727517276172771727817279172801728117282172831728417285172861728717288172891729017291172921729317294172951729617297172981729917300173011730217303173041730517306173071730817309173101731117312173131731417315173161731717318173191732017321173221732317324173251732617327173281732917330173311733217333173341733517336173371733817339173401734117342173431734417345173461734717348173491735017351173521735317354173551735617357173581735917360173611736217363173641736517366173671736817369173701737117372173731737417375173761737717378173791738017381173821738317384173851738617387173881738917390173911739217393173941739517396173971739817399174001740117402174031740417405174061740717408174091741017411174121741317414174151741617417174181741917420174211742217423174241742517426174271742817429174301743117432174331743417435174361743717438174391744017441174421744317444174451744617447174481744917450174511745217453174541745517456174571745817459174601746117462174631746417465174661746717468174691747017471174721747317474174751747617477174781747917480174811748217483174841748517486174871748817489174901749117492174931749417495174961749717498174991750017501175021750317504175051750617507175081750917510175111751217513175141751517516175171751817519175201752117522175231752417525175261752717528175291753017531175321753317534175351753617537175381753917540175411754217543175441754517546175471754817549175501755117552175531755417555175561755717558175591756017561175621756317564175651756617567175681756917570175711757217573175741757517576175771757817579175801758117582175831758417585175861758717588175891759017591175921759317594175951759617597175981759917600176011760217603176041760517606176071760817609176101761117612176131761417615176161761717618176191762017621176221762317624176251762617627176281762917630176311763217633176341763517636176371763817639176401764117642176431764417645176461764717648176491765017651176521765317654176551765617657176581765917660176611766217663176641766517666176671766817669176701767117672176731767417675176761767717678176791768017681176821768317684176851768617687176881768917690176911769217693176941769517696176971769817699177001770117702177031770417705177061770717708177091771017711177121771317714177151771617717177181771917720177211772217723177241772517726177271772817729177301773117732177331773417735177361773717738177391774017741177421774317744177451774617747177481774917750177511775217753177541775517756177571775817759177601776117762177631776417765177661776717768177691777017771177721777317774177751777617777177781777917780177811778217783177841778517786177871778817789177901779117792177931779417795177961779717798177991780017801178021780317804178051780617807178081780917810178111781217813178141781517816178171781817819178201782117822178231782417825178261782717828178291783017831178321783317834178351783617837178381783917840178411784217843178441784517846178471784817849178501785117852178531785417855178561785717858178591786017861178621786317864178651786617867178681786917870178711787217873178741787517876178771787817879178801788117882178831788417885178861788717888178891789017891178921789317894178951789617897178981789917900179011790217903179041790517906179071790817909179101791117912179131791417915179161791717918179191792017921179221792317924179251792617927179281792917930179311793217933179341793517936179371793817939179401794117942179431794417945179461794717948179491795017951179521795317954179551795617957179581795917960179611796217963179641796517966179671796817969179701797117972179731797417975179761797717978179791798017981179821798317984179851798617987179881798917990179911799217993179941799517996179971799817999180001800118002180031800418005180061800718008180091801018011180121801318014180151801618017180181801918020180211802218023180241802518026180271802818029180301803118032180331803418035180361803718038180391804018041180421804318044180451804618047180481804918050180511805218053180541805518056180571805818059180601806118062180631806418065180661806718068180691807018071180721807318074180751807618077180781807918080180811808218083180841808518086180871808818089180901809118092180931809418095180961809718098180991810018101181021810318104181051810618107181081810918110181111811218113181141811518116181171811818119181201812118122181231812418125181261812718128181291813018131181321813318134181351813618137181381813918140181411814218143181441814518146181471814818149181501815118152181531815418155181561815718158181591816018161181621816318164181651816618167181681816918170181711817218173181741817518176181771817818179181801818118182181831818418185181861818718188181891819018191181921819318194181951819618197181981819918200182011820218203182041820518206182071820818209182101821118212182131821418215182161821718218182191822018221182221822318224182251822618227182281822918230182311823218233182341823518236182371823818239182401824118242182431824418245182461824718248182491825018251182521825318254182551825618257182581825918260182611826218263182641826518266182671826818269182701827118272182731827418275182761827718278182791828018281182821828318284182851828618287182881828918290182911829218293182941829518296182971829818299183001830118302183031830418305183061830718308183091831018311183121831318314183151831618317183181831918320183211832218323183241832518326183271832818329183301833118332183331833418335183361833718338183391834018341183421834318344183451834618347183481834918350183511835218353183541835518356183571835818359183601836118362183631836418365183661836718368183691837018371183721837318374183751837618377183781837918380183811838218383183841838518386183871838818389183901839118392183931839418395183961839718398183991840018401184021840318404184051840618407184081840918410184111841218413184141841518416184171841818419184201842118422184231842418425184261842718428184291843018431184321843318434184351843618437184381843918440184411844218443184441844518446184471844818449184501845118452184531845418455184561845718458184591846018461184621846318464184651846618467184681846918470184711847218473184741847518476184771847818479184801848118482184831848418485184861848718488184891849018491184921849318494184951849618497184981849918500185011850218503185041850518506185071850818509185101851118512185131851418515185161851718518185191852018521185221852318524185251852618527185281852918530185311853218533185341853518536185371853818539185401854118542185431854418545185461854718548185491855018551185521855318554185551855618557185581855918560185611856218563185641856518566185671856818569185701857118572185731857418575185761857718578185791858018581185821858318584185851858618587185881858918590185911859218593185941859518596185971859818599186001860118602186031860418605186061860718608186091861018611186121861318614186151861618617186181861918620186211862218623186241862518626186271862818629186301863118632186331863418635186361863718638186391864018641186421864318644186451864618647186481864918650186511865218653186541865518656186571865818659186601866118662186631866418665186661866718668186691867018671186721867318674186751867618677186781867918680186811868218683186841868518686186871868818689186901869118692186931869418695186961869718698186991870018701187021870318704187051870618707187081870918710187111871218713187141871518716187171871818719187201872118722187231872418725187261872718728187291873018731187321873318734187351873618737187381873918740187411874218743187441874518746187471874818749187501875118752187531875418755187561875718758187591876018761187621876318764187651876618767187681876918770187711877218773187741877518776187771877818779187801878118782187831878418785187861878718788187891879018791187921879318794187951879618797187981879918800188011880218803188041880518806188071880818809188101881118812188131881418815188161881718818188191882018821188221882318824188251882618827188281882918830188311883218833188341883518836188371883818839188401884118842188431884418845188461884718848188491885018851188521885318854188551885618857188581885918860188611886218863188641886518866188671886818869188701887118872188731887418875188761887718878188791888018881188821888318884188851888618887188881888918890188911889218893188941889518896188971889818899189001890118902189031890418905189061890718908189091891018911189121891318914189151891618917189181891918920189211892218923189241892518926189271892818929189301893118932189331893418935189361893718938189391894018941189421894318944189451894618947189481894918950189511895218953189541895518956189571895818959189601896118962189631896418965189661896718968189691897018971189721897318974189751897618977189781897918980189811898218983189841898518986189871898818989189901899118992189931899418995189961899718998189991900019001190021900319004190051900619007190081900919010190111901219013190141901519016190171901819019190201902119022190231902419025190261902719028190291903019031190321903319034190351903619037190381903919040190411904219043190441904519046190471904819049190501905119052190531905419055190561905719058190591906019061190621906319064190651906619067190681906919070190711907219073190741907519076190771907819079190801908119082190831908419085190861908719088190891909019091190921909319094190951909619097190981909919100191011910219103191041910519106191071910819109191101911119112191131911419115191161911719118191191912019121191221912319124191251912619127191281912919130191311913219133191341913519136191371913819139191401914119142191431914419145191461914719148191491915019151191521915319154191551915619157191581915919160191611916219163191641916519166191671916819169191701917119172191731917419175191761917719178191791918019181191821918319184191851918619187191881918919190191911919219193191941919519196191971919819199192001920119202192031920419205192061920719208192091921019211192121921319214192151921619217192181921919220192211922219223192241922519226192271922819229192301923119232192331923419235192361923719238192391924019241192421924319244192451924619247192481924919250192511925219253192541925519256192571925819259192601926119262192631926419265192661926719268192691927019271192721927319274192751927619277192781927919280192811928219283192841928519286192871928819289192901929119292192931929419295192961929719298192991930019301193021930319304193051930619307193081930919310193111931219313193141931519316193171931819319193201932119322193231932419325193261932719328193291933019331193321933319334193351933619337193381933919340193411934219343193441934519346193471934819349193501935119352193531935419355193561935719358193591936019361193621936319364193651936619367193681936919370193711937219373193741937519376193771937819379193801938119382193831938419385193861938719388193891939019391193921939319394193951939619397193981939919400194011940219403194041940519406194071940819409194101941119412194131941419415194161941719418194191942019421194221942319424194251942619427194281942919430194311943219433194341943519436194371943819439194401944119442194431944419445194461944719448194491945019451194521945319454194551945619457194581945919460194611946219463194641946519466194671946819469194701947119472194731947419475194761947719478194791948019481194821948319484194851948619487194881948919490194911949219493194941949519496194971949819499195001950119502195031950419505195061950719508195091951019511195121951319514195151951619517195181951919520195211952219523195241952519526195271952819529195301953119532195331953419535195361953719538195391954019541195421954319544195451954619547195481954919550195511955219553195541955519556195571955819559195601956119562195631956419565195661956719568195691957019571195721957319574195751957619577195781957919580195811958219583195841958519586195871958819589195901959119592195931959419595195961959719598195991960019601196021960319604196051960619607196081960919610196111961219613196141961519616196171961819619196201962119622196231962419625196261962719628196291963019631196321963319634196351963619637196381963919640196411964219643196441964519646196471964819649196501965119652196531965419655196561965719658196591966019661196621966319664196651966619667196681966919670196711967219673196741967519676196771967819679196801968119682196831968419685196861968719688196891969019691196921969319694196951969619697196981969919700197011970219703197041970519706197071970819709197101971119712197131971419715197161971719718197191972019721197221972319724197251972619727197281972919730197311973219733197341973519736197371973819739197401974119742197431974419745197461974719748197491975019751197521975319754197551975619757197581975919760197611976219763197641976519766197671976819769197701977119772197731977419775197761977719778197791978019781197821978319784197851978619787197881978919790197911979219793197941979519796197971979819799198001980119802198031980419805198061980719808198091981019811198121981319814198151981619817198181981919820198211982219823198241982519826198271982819829198301983119832198331983419835198361983719838198391984019841198421984319844198451984619847198481984919850198511985219853198541985519856198571985819859198601986119862198631986419865198661986719868198691987019871198721987319874198751987619877198781987919880198811988219883198841988519886198871988819889198901989119892198931989419895198961989719898198991990019901199021990319904199051990619907199081990919910199111991219913199141991519916199171991819919199201992119922199231992419925199261992719928199291993019931199321993319934199351993619937199381993919940199411994219943199441994519946199471994819949199501995119952199531995419955199561995719958199591996019961199621996319964199651996619967199681996919970199711997219973199741997519976199771997819979199801998119982199831998419985199861998719988199891999019991199921999319994199951999619997199981999920000200012000220003200042000520006200072000820009200102001120012200132001420015200162001720018200192002020021200222002320024200252002620027200282002920030200312003220033200342003520036200372003820039200402004120042200432004420045200462004720048200492005020051200522005320054200552005620057200582005920060200612006220063200642006520066200672006820069200702007120072200732007420075200762007720078200792008020081200822008320084200852008620087200882008920090200912009220093200942009520096200972009820099201002010120102201032010420105201062010720108201092011020111201122011320114201152011620117201182011920120201212012220123201242012520126201272012820129201302013120132201332013420135201362013720138201392014020141201422014320144201452014620147201482014920150201512015220153201542015520156201572015820159201602016120162201632016420165201662016720168201692017020171201722017320174201752017620177201782017920180201812018220183201842018520186201872018820189201902019120192201932019420195201962019720198201992020020201202022020320204202052020620207202082020920210202112021220213202142021520216202172021820219202202022120222202232022420225202262022720228202292023020231202322023320234202352023620237202382023920240202412024220243202442024520246202472024820249202502025120252202532025420255202562025720258202592026020261202622026320264202652026620267202682026920270202712027220273202742027520276202772027820279202802028120282202832028420285202862028720288202892029020291202922029320294202952029620297202982029920300203012030220303203042030520306203072030820309203102031120312203132031420315203162031720318203192032020321203222032320324203252032620327203282032920330203312033220333203342033520336203372033820339203402034120342203432034420345203462034720348203492035020351203522035320354203552035620357203582035920360203612036220363203642036520366203672036820369203702037120372203732037420375203762037720378203792038020381203822038320384203852038620387203882038920390203912039220393203942039520396203972039820399204002040120402204032040420405204062040720408204092041020411204122041320414204152041620417204182041920420204212042220423204242042520426204272042820429204302043120432204332043420435204362043720438204392044020441204422044320444204452044620447204482044920450204512045220453204542045520456204572045820459204602046120462204632046420465204662046720468204692047020471204722047320474204752047620477204782047920480204812048220483204842048520486204872048820489204902049120492204932049420495204962049720498204992050020501205022050320504205052050620507205082050920510205112051220513205142051520516205172051820519205202052120522205232052420525205262052720528205292053020531205322053320534205352053620537205382053920540205412054220543205442054520546205472054820549205502055120552205532055420555205562055720558205592056020561205622056320564205652056620567205682056920570205712057220573205742057520576205772057820579205802058120582205832058420585205862058720588205892059020591205922059320594205952059620597205982059920600206012060220603206042060520606206072060820609206102061120612206132061420615206162061720618206192062020621206222062320624206252062620627206282062920630206312063220633206342063520636206372063820639206402064120642206432064420645206462064720648206492065020651206522065320654206552065620657206582065920660206612066220663206642066520666206672066820669206702067120672206732067420675206762067720678206792068020681206822068320684206852068620687206882068920690206912069220693206942069520696206972069820699207002070120702207032070420705207062070720708207092071020711207122071320714207152071620717207182071920720207212072220723207242072520726207272072820729207302073120732207332073420735207362073720738207392074020741207422074320744207452074620747207482074920750207512075220753207542075520756207572075820759207602076120762207632076420765207662076720768207692077020771207722077320774207752077620777207782077920780207812078220783207842078520786207872078820789207902079120792207932079420795207962079720798207992080020801208022080320804208052080620807208082080920810208112081220813208142081520816208172081820819208202082120822208232082420825208262082720828208292083020831208322083320834208352083620837208382083920840208412084220843208442084520846208472084820849208502085120852208532085420855208562085720858208592086020861208622086320864208652086620867208682086920870208712087220873208742087520876208772087820879208802088120882208832088420885208862088720888208892089020891208922089320894208952089620897208982089920900209012090220903209042090520906209072090820909209102091120912209132091420915209162091720918209192092020921209222092320924209252092620927209282092920930209312093220933209342093520936209372093820939209402094120942209432094420945209462094720948209492095020951209522095320954209552095620957209582095920960209612096220963209642096520966209672096820969209702097120972209732097420975209762097720978209792098020981209822098320984209852098620987209882098920990209912099220993209942099520996209972099820999210002100121002210032100421005210062100721008210092101021011210122101321014210152101621017210182101921020210212102221023210242102521026210272102821029210302103121032210332103421035210362103721038210392104021041210422104321044210452104621047210482104921050210512105221053210542105521056210572105821059210602106121062210632106421065210662106721068210692107021071210722107321074210752107621077210782107921080210812108221083210842108521086210872108821089210902109121092210932109421095210962109721098210992110021101211022110321104211052110621107211082110921110211112111221113211142111521116211172111821119211202112121122211232112421125211262112721128211292113021131211322113321134211352113621137211382113921140211412114221143211442114521146211472114821149211502115121152211532115421155211562115721158211592116021161211622116321164211652116621167211682116921170211712117221173211742117521176211772117821179211802118121182211832118421185211862118721188211892119021191211922119321194211952119621197211982119921200212012120221203212042120521206212072120821209212102121121212212132121421215212162121721218212192122021221212222122321224212252122621227212282122921230212312123221233212342123521236212372123821239212402124121242212432124421245212462124721248212492125021251212522125321254212552125621257212582125921260212612126221263212642126521266212672126821269212702127121272212732127421275212762127721278212792128021281212822128321284212852128621287212882128921290212912129221293212942129521296212972129821299213002130121302213032130421305213062130721308213092131021311213122131321314213152131621317213182131921320213212132221323213242132521326213272132821329213302133121332213332133421335213362133721338213392134021341213422134321344213452134621347213482134921350213512135221353213542135521356213572135821359213602136121362213632136421365213662136721368213692137021371213722137321374213752137621377213782137921380213812138221383213842138521386213872138821389213902139121392213932139421395213962139721398213992140021401214022140321404214052140621407214082140921410214112141221413214142141521416214172141821419214202142121422214232142421425214262142721428214292143021431214322143321434214352143621437214382143921440214412144221443214442144521446214472144821449214502145121452214532145421455214562145721458214592146021461214622146321464214652146621467214682146921470214712147221473214742147521476214772147821479214802148121482214832148421485214862148721488214892149021491214922149321494214952149621497214982149921500215012150221503215042150521506215072150821509215102151121512215132151421515215162151721518215192152021521215222152321524215252152621527215282152921530215312153221533215342153521536215372153821539215402154121542215432154421545215462154721548215492155021551215522155321554215552155621557215582155921560215612156221563215642156521566215672156821569215702157121572215732157421575215762157721578215792158021581215822158321584215852158621587215882158921590215912159221593215942159521596215972159821599216002160121602216032160421605216062160721608216092161021611216122161321614216152161621617216182161921620216212162221623216242162521626216272162821629216302163121632216332163421635216362163721638216392164021641216422164321644216452164621647216482164921650216512165221653216542165521656216572165821659216602166121662216632166421665216662166721668216692167021671216722167321674216752167621677216782167921680216812168221683216842168521686216872168821689216902169121692216932169421695216962169721698216992170021701217022170321704217052170621707217082170921710217112171221713217142171521716217172171821719217202172121722217232172421725217262172721728217292173021731217322173321734217352173621737217382173921740217412174221743217442174521746217472174821749217502175121752217532175421755217562175721758217592176021761217622176321764217652176621767217682176921770217712177221773217742177521776217772177821779217802178121782217832178421785217862178721788217892179021791217922179321794217952179621797217982179921800218012180221803218042180521806218072180821809218102181121812218132181421815218162181721818218192182021821218222182321824218252182621827218282182921830218312183221833218342183521836218372183821839218402184121842218432184421845218462184721848218492185021851218522185321854218552185621857218582185921860218612186221863218642186521866218672186821869218702187121872218732187421875218762187721878218792188021881218822188321884218852188621887218882188921890218912189221893218942189521896218972189821899219002190121902219032190421905219062190721908219092191021911219122191321914219152191621917219182191921920219212192221923219242192521926219272192821929219302193121932219332193421935219362193721938219392194021941219422194321944219452194621947219482194921950219512195221953219542195521956219572195821959219602196121962219632196421965219662196721968219692197021971219722197321974219752197621977219782197921980219812198221983219842198521986219872198821989219902199121992219932199421995219962199721998219992200022001220022200322004220052200622007220082200922010220112201222013220142201522016220172201822019220202202122022220232202422025220262202722028220292203022031220322203322034220352203622037220382203922040220412204222043220442204522046220472204822049220502205122052220532205422055220562205722058220592206022061220622206322064220652206622067220682206922070220712207222073220742207522076220772207822079220802208122082220832208422085220862208722088220892209022091220922209322094220952209622097220982209922100221012210222103221042210522106221072210822109221102211122112221132211422115221162211722118221192212022121221222212322124221252212622127221282212922130221312213222133221342213522136221372213822139221402214122142221432214422145221462214722148221492215022151221522215322154221552215622157221582215922160221612216222163221642216522166221672216822169221702217122172221732217422175221762217722178221792218022181221822218322184221852218622187221882218922190221912219222193221942219522196221972219822199222002220122202222032220422205222062220722208222092221022211222122221322214222152221622217222182221922220222212222222223222242222522226222272222822229222302223122232222332223422235222362223722238222392224022241222422224322244222452224622247222482224922250222512225222253222542225522256222572225822259222602226122262222632226422265222662226722268222692227022271222722227322274222752227622277222782227922280222812228222283222842228522286222872228822289222902229122292222932229422295222962229722298222992230022301223022230322304223052230622307223082230922310223112231222313223142231522316223172231822319223202232122322223232232422325223262232722328223292233022331223322233322334223352233622337223382233922340223412234222343223442234522346223472234822349223502235122352223532235422355223562235722358223592236022361223622236322364223652236622367223682236922370223712237222373223742237522376223772237822379223802238122382223832238422385223862238722388223892239022391223922239322394223952239622397223982239922400224012240222403224042240522406224072240822409224102241122412224132241422415224162241722418224192242022421224222242322424224252242622427224282242922430224312243222433224342243522436224372243822439224402244122442224432244422445224462244722448224492245022451224522245322454224552245622457224582245922460224612246222463224642246522466224672246822469224702247122472224732247422475224762247722478224792248022481224822248322484224852248622487224882248922490224912249222493224942249522496224972249822499225002250122502225032250422505225062250722508225092251022511225122251322514225152251622517225182251922520225212252222523225242252522526225272252822529225302253122532225332253422535225362253722538225392254022541225422254322544225452254622547225482254922550225512255222553225542255522556225572255822559225602256122562225632256422565225662256722568225692257022571225722257322574225752257622577225782257922580225812258222583225842258522586225872258822589225902259122592225932259422595225962259722598225992260022601226022260322604226052260622607226082260922610226112261222613226142261522616226172261822619226202262122622226232262422625226262262722628226292263022631226322263322634226352263622637226382263922640226412264222643226442264522646226472264822649226502265122652226532265422655226562265722658226592266022661226622266322664226652266622667226682266922670226712267222673226742267522676226772267822679226802268122682226832268422685226862268722688226892269022691226922269322694226952269622697226982269922700227012270222703227042270522706227072270822709227102271122712227132271422715227162271722718227192272022721227222272322724227252272622727227282272922730227312273222733227342273522736227372273822739227402274122742227432274422745227462274722748227492275022751227522275322754227552275622757227582275922760227612276222763227642276522766227672276822769227702277122772227732277422775227762277722778227792278022781227822278322784227852278622787227882278922790227912279222793227942279522796227972279822799228002280122802228032280422805228062280722808228092281022811228122281322814228152281622817228182281922820228212282222823228242282522826228272282822829228302283122832228332283422835228362283722838228392284022841228422284322844228452284622847228482284922850228512285222853228542285522856228572285822859228602286122862228632286422865228662286722868228692287022871228722287322874228752287622877228782287922880228812288222883228842288522886228872288822889228902289122892228932289422895228962289722898228992290022901229022290322904229052290622907229082290922910229112291222913229142291522916229172291822919229202292122922229232292422925229262292722928229292293022931229322293322934229352293622937229382293922940229412294222943229442294522946229472294822949229502295122952229532295422955229562295722958229592296022961229622296322964229652296622967229682296922970229712297222973229742297522976229772297822979229802298122982229832298422985229862298722988229892299022991229922299322994229952299622997229982299923000230012300223003230042300523006230072300823009230102301123012230132301423015230162301723018230192302023021230222302323024230252302623027230282302923030230312303223033230342303523036230372303823039230402304123042230432304423045230462304723048230492305023051230522305323054230552305623057230582305923060230612306223063230642306523066230672306823069230702307123072230732307423075230762307723078230792308023081230822308323084230852308623087230882308923090230912309223093230942309523096230972309823099231002310123102231032310423105231062310723108231092311023111231122311323114231152311623117231182311923120231212312223123231242312523126231272312823129231302313123132231332313423135231362313723138231392314023141231422314323144231452314623147231482314923150231512315223153231542315523156231572315823159231602316123162231632316423165231662316723168231692317023171231722317323174231752317623177231782317923180231812318223183231842318523186231872318823189231902319123192231932319423195231962319723198231992320023201232022320323204232052320623207232082320923210232112321223213232142321523216232172321823219232202322123222232232322423225232262322723228232292323023231232322323323234232352323623237232382323923240232412324223243232442324523246232472324823249232502325123252232532325423255232562325723258232592326023261232622326323264232652326623267232682326923270232712327223273232742327523276232772327823279232802328123282232832328423285232862328723288232892329023291232922329323294232952329623297232982329923300233012330223303233042330523306233072330823309233102331123312233132331423315233162331723318233192332023321233222332323324233252332623327233282332923330233312333223333233342333523336233372333823339233402334123342233432334423345233462334723348233492335023351233522335323354233552335623357233582335923360233612336223363233642336523366233672336823369233702337123372233732337423375233762337723378233792338023381233822338323384233852338623387233882338923390233912339223393233942339523396233972339823399234002340123402234032340423405234062340723408234092341023411234122341323414234152341623417234182341923420234212342223423234242342523426234272342823429234302343123432234332343423435234362343723438234392344023441234422344323444234452344623447234482344923450234512345223453234542345523456234572345823459234602346123462234632346423465234662346723468234692347023471234722347323474234752347623477234782347923480234812348223483234842348523486234872348823489234902349123492234932349423495234962349723498234992350023501235022350323504235052350623507235082350923510235112351223513235142351523516235172351823519235202352123522235232352423525235262352723528235292353023531235322353323534235352353623537235382353923540235412354223543235442354523546235472354823549235502355123552235532355423555235562355723558235592356023561235622356323564235652356623567235682356923570235712357223573235742357523576235772357823579235802358123582235832358423585235862358723588235892359023591235922359323594235952359623597235982359923600236012360223603236042360523606236072360823609236102361123612236132361423615236162361723618236192362023621236222362323624236252362623627236282362923630236312363223633236342363523636236372363823639236402364123642236432364423645236462364723648236492365023651236522365323654236552365623657236582365923660236612366223663236642366523666236672366823669236702367123672236732367423675236762367723678236792368023681236822368323684236852368623687236882368923690236912369223693236942369523696236972369823699237002370123702237032370423705237062370723708237092371023711237122371323714237152371623717237182371923720237212372223723237242372523726237272372823729237302373123732237332373423735237362373723738237392374023741237422374323744237452374623747237482374923750237512375223753237542375523756237572375823759237602376123762237632376423765237662376723768237692377023771237722377323774237752377623777237782377923780237812378223783237842378523786237872378823789237902379123792237932379423795237962379723798237992380023801238022380323804238052380623807238082380923810238112381223813238142381523816238172381823819238202382123822238232382423825238262382723828238292383023831238322383323834238352383623837238382383923840238412384223843238442384523846238472384823849238502385123852238532385423855238562385723858238592386023861238622386323864238652386623867238682386923870238712387223873238742387523876238772387823879238802388123882238832388423885238862388723888238892389023891238922389323894238952389623897238982389923900239012390223903239042390523906239072390823909239102391123912239132391423915239162391723918239192392023921239222392323924239252392623927239282392923930239312393223933239342393523936239372393823939239402394123942239432394423945239462394723948239492395023951239522395323954239552395623957239582395923960239612396223963239642396523966239672396823969239702397123972239732397423975239762397723978239792398023981239822398323984239852398623987239882398923990239912399223993239942399523996239972399823999240002400124002240032400424005240062400724008240092401024011240122401324014240152401624017240182401924020240212402224023240242402524026240272402824029240302403124032240332403424035240362403724038240392404024041240422404324044240452404624047240482404924050240512405224053240542405524056240572405824059240602406124062240632406424065240662406724068240692407024071240722407324074240752407624077240782407924080240812408224083240842408524086240872408824089240902409124092240932409424095240962409724098240992410024101241022410324104241052410624107241082410924110241112411224113241142411524116241172411824119241202412124122241232412424125241262412724128241292413024131241322413324134241352413624137241382413924140241412414224143241442414524146241472414824149241502415124152241532415424155241562415724158241592416024161241622416324164241652416624167241682416924170241712417224173241742417524176241772417824179241802418124182241832418424185241862418724188241892419024191241922419324194241952419624197241982419924200242012420224203242042420524206242072420824209242102421124212242132421424215242162421724218242192422024221242222422324224242252422624227242282422924230242312423224233242342423524236242372423824239242402424124242242432424424245242462424724248242492425024251242522425324254242552425624257242582425924260242612426224263242642426524266242672426824269242702427124272242732427424275242762427724278242792428024281242822428324284242852428624287242882428924290242912429224293242942429524296242972429824299243002430124302243032430424305243062430724308243092431024311243122431324314243152431624317243182431924320243212432224323243242432524326243272432824329243302433124332243332433424335243362433724338243392434024341243422434324344243452434624347243482434924350243512435224353243542435524356243572435824359243602436124362243632436424365243662436724368243692437024371243722437324374243752437624377243782437924380243812438224383243842438524386243872438824389243902439124392243932439424395243962439724398243992440024401244022440324404244052440624407244082440924410244112441224413244142441524416244172441824419244202442124422244232442424425244262442724428244292443024431244322443324434244352443624437244382443924440244412444224443244442444524446244472444824449244502445124452244532445424455244562445724458244592446024461244622446324464244652446624467244682446924470244712447224473244742447524476244772447824479244802448124482244832448424485244862448724488244892449024491244922449324494244952449624497244982449924500245012450224503245042450524506245072450824509245102451124512245132451424515245162451724518245192452024521245222452324524245252452624527245282452924530245312453224533245342453524536245372453824539245402454124542245432454424545245462454724548245492455024551245522455324554245552455624557245582455924560245612456224563245642456524566245672456824569245702457124572245732457424575245762457724578245792458024581245822458324584245852458624587245882458924590245912459224593245942459524596245972459824599246002460124602246032460424605246062460724608246092461024611246122461324614246152461624617246182461924620246212462224623246242462524626246272462824629246302463124632246332463424635246362463724638246392464024641246422464324644246452464624647246482464924650246512465224653246542465524656246572465824659246602466124662246632466424665246662466724668246692467024671246722467324674246752467624677246782467924680246812468224683246842468524686246872468824689246902469124692246932469424695246962469724698246992470024701247022470324704247052470624707247082470924710247112471224713247142471524716247172471824719247202472124722247232472424725247262472724728247292473024731247322473324734247352473624737247382473924740247412474224743247442474524746247472474824749247502475124752247532475424755247562475724758247592476024761247622476324764247652476624767247682476924770247712477224773247742477524776247772477824779247802478124782247832478424785247862478724788247892479024791247922479324794247952479624797247982479924800248012480224803248042480524806248072480824809248102481124812248132481424815248162481724818248192482024821248222482324824248252482624827248282482924830248312483224833248342483524836248372483824839248402484124842248432484424845248462484724848248492485024851248522485324854248552485624857248582485924860248612486224863248642486524866248672486824869248702487124872248732487424875248762487724878248792488024881248822488324884248852488624887248882488924890248912489224893248942489524896248972489824899249002490124902249032490424905249062490724908249092491024911249122491324914249152491624917249182491924920249212492224923249242492524926249272492824929249302493124932249332493424935249362493724938249392494024941249422494324944249452494624947249482494924950249512495224953249542495524956249572495824959249602496124962249632496424965249662496724968249692497024971249722497324974249752497624977249782497924980249812498224983249842498524986249872498824989249902499124992249932499424995249962499724998249992500025001250022500325004250052500625007250082500925010250112501225013250142501525016250172501825019250202502125022250232502425025250262502725028250292503025031250322503325034250352503625037250382503925040250412504225043250442504525046250472504825049250502505125052250532505425055250562505725058250592506025061250622506325064250652506625067250682506925070250712507225073250742507525076250772507825079250802508125082250832508425085250862508725088250892509025091250922509325094250952509625097250982509925100251012510225103251042510525106251072510825109251102511125112251132511425115251162511725118251192512025121251222512325124251252512625127251282512925130251312513225133251342513525136251372513825139251402514125142251432514425145251462514725148251492515025151251522515325154251552515625157251582515925160251612516225163251642516525166251672516825169251702517125172251732517425175251762517725178251792518025181251822518325184251852518625187251882518925190251912519225193251942519525196251972519825199252002520125202252032520425205252062520725208252092521025211252122521325214252152521625217252182521925220252212522225223252242522525226252272522825229252302523125232252332523425235252362523725238252392524025241252422524325244252452524625247252482524925250252512525225253252542525525256252572525825259252602526125262252632526425265252662526725268252692527025271252722527325274252752527625277252782527925280252812528225283252842528525286252872528825289252902529125292252932529425295252962529725298252992530025301253022530325304253052530625307253082530925310253112531225313253142531525316253172531825319253202532125322253232532425325253262532725328253292533025331253322533325334253352533625337253382533925340253412534225343253442534525346253472534825349253502535125352253532535425355253562535725358253592536025361253622536325364253652536625367253682536925370253712537225373253742537525376253772537825379253802538125382253832538425385253862538725388253892539025391253922539325394253952539625397253982539925400254012540225403254042540525406254072540825409254102541125412254132541425415254162541725418254192542025421254222542325424254252542625427254282542925430254312543225433254342543525436254372543825439254402544125442254432544425445254462544725448254492545025451254522545325454254552545625457254582545925460254612546225463254642546525466254672546825469254702547125472254732547425475254762547725478254792548025481254822548325484254852548625487254882548925490254912549225493254942549525496254972549825499255002550125502255032550425505255062550725508255092551025511255122551325514255152551625517255182551925520255212552225523255242552525526255272552825529255302553125532255332553425535255362553725538255392554025541255422554325544255452554625547255482554925550255512555225553255542555525556255572555825559255602556125562255632556425565255662556725568255692557025571255722557325574255752557625577255782557925580255812558225583255842558525586255872558825589255902559125592255932559425595255962559725598255992560025601256022560325604256052560625607256082560925610256112561225613256142561525616256172561825619256202562125622256232562425625256262562725628256292563025631256322563325634256352563625637256382563925640256412564225643256442564525646256472564825649256502565125652256532565425655256562565725658256592566025661256622566325664256652566625667256682566925670256712567225673256742567525676256772567825679256802568125682256832568425685256862568725688256892569025691256922569325694256952569625697256982569925700257012570225703257042570525706257072570825709257102571125712257132571425715257162571725718257192572025721257222572325724257252572625727257282572925730257312573225733257342573525736257372573825739257402574125742257432574425745257462574725748257492575025751257522575325754257552575625757257582575925760257612576225763257642576525766257672576825769257702577125772257732577425775257762577725778257792578025781257822578325784257852578625787257882578925790257912579225793257942579525796257972579825799258002580125802258032580425805258062580725808258092581025811258122581325814258152581625817258182581925820258212582225823258242582525826258272582825829258302583125832258332583425835258362583725838258392584025841258422584325844258452584625847258482584925850258512585225853258542585525856258572585825859258602586125862258632586425865258662586725868258692587025871258722587325874258752587625877258782587925880258812588225883258842588525886258872588825889258902589125892258932589425895258962589725898258992590025901259022590325904259052590625907259082590925910259112591225913259142591525916259172591825919259202592125922259232592425925259262592725928259292593025931259322593325934259352593625937259382593925940259412594225943259442594525946259472594825949259502595125952259532595425955259562595725958259592596025961259622596325964259652596625967259682596925970259712597225973259742597525976259772597825979259802598125982259832598425985259862598725988259892599025991259922599325994259952599625997259982599926000260012600226003260042600526006260072600826009260102601126012260132601426015260162601726018260192602026021260222602326024260252602626027260282602926030260312603226033260342603526036260372603826039260402604126042260432604426045260462604726048260492605026051260522605326054260552605626057260582605926060260612606226063260642606526066260672606826069260702607126072260732607426075260762607726078260792608026081260822608326084260852608626087260882608926090260912609226093260942609526096260972609826099261002610126102261032610426105261062610726108261092611026111261122611326114261152611626117261182611926120261212612226123261242612526126261272612826129261302613126132261332613426135261362613726138261392614026141261422614326144261452614626147261482614926150261512615226153261542615526156261572615826159261602616126162261632616426165261662616726168261692617026171261722617326174261752617626177261782617926180261812618226183261842618526186261872618826189261902619126192261932619426195261962619726198261992620026201262022620326204262052620626207262082620926210262112621226213262142621526216262172621826219262202622126222262232622426225262262622726228262292623026231262322623326234262352623626237262382623926240262412624226243262442624526246262472624826249262502625126252262532625426255262562625726258262592626026261262622626326264262652626626267262682626926270262712627226273262742627526276262772627826279262802628126282262832628426285262862628726288262892629026291262922629326294262952629626297262982629926300263012630226303263042630526306263072630826309263102631126312263132631426315263162631726318263192632026321263222632326324263252632626327263282632926330263312633226333263342633526336263372633826339263402634126342263432634426345263462634726348263492635026351263522635326354263552635626357263582635926360263612636226363263642636526366263672636826369263702637126372263732637426375263762637726378263792638026381263822638326384263852638626387263882638926390263912639226393263942639526396263972639826399264002640126402264032640426405264062640726408264092641026411264122641326414264152641626417264182641926420264212642226423264242642526426264272642826429264302643126432264332643426435264362643726438264392644026441264422644326444264452644626447264482644926450264512645226453264542645526456264572645826459264602646126462264632646426465264662646726468264692647026471264722647326474264752647626477264782647926480264812648226483264842648526486264872648826489264902649126492264932649426495264962649726498264992650026501265022650326504265052650626507265082650926510265112651226513265142651526516265172651826519265202652126522265232652426525265262652726528265292653026531265322653326534265352653626537265382653926540265412654226543265442654526546265472654826549265502655126552265532655426555265562655726558265592656026561265622656326564265652656626567265682656926570265712657226573265742657526576265772657826579265802658126582265832658426585265862658726588265892659026591265922659326594265952659626597265982659926600266012660226603266042660526606266072660826609266102661126612266132661426615266162661726618266192662026621266222662326624266252662626627266282662926630266312663226633266342663526636266372663826639266402664126642266432664426645266462664726648266492665026651266522665326654266552665626657266582665926660266612666226663266642666526666266672666826669266702667126672266732667426675266762667726678266792668026681266822668326684266852668626687266882668926690266912669226693266942669526696266972669826699267002670126702267032670426705267062670726708267092671026711267122671326714267152671626717267182671926720267212672226723267242672526726267272672826729267302673126732267332673426735267362673726738267392674026741267422674326744267452674626747267482674926750267512675226753267542675526756267572675826759267602676126762267632676426765267662676726768267692677026771267722677326774267752677626777267782677926780267812678226783267842678526786267872678826789267902679126792267932679426795267962679726798267992680026801268022680326804268052680626807268082680926810268112681226813268142681526816268172681826819268202682126822268232682426825268262682726828268292683026831268322683326834268352683626837268382683926840268412684226843268442684526846268472684826849268502685126852268532685426855268562685726858268592686026861268622686326864268652686626867268682686926870268712687226873268742687526876268772687826879268802688126882268832688426885268862688726888268892689026891268922689326894268952689626897268982689926900269012690226903269042690526906269072690826909269102691126912269132691426915269162691726918269192692026921269222692326924269252692626927269282692926930269312693226933269342693526936269372693826939269402694126942269432694426945269462694726948269492695026951269522695326954269552695626957269582695926960269612696226963269642696526966269672696826969269702697126972269732697426975269762697726978269792698026981269822698326984269852698626987269882698926990269912699226993269942699526996269972699826999270002700127002270032700427005270062700727008270092701027011270122701327014270152701627017270182701927020270212702227023270242702527026270272702827029270302703127032270332703427035270362703727038270392704027041270422704327044270452704627047270482704927050270512705227053270542705527056270572705827059270602706127062270632706427065270662706727068270692707027071270722707327074270752707627077270782707927080270812708227083270842708527086270872708827089270902709127092270932709427095270962709727098270992710027101271022710327104271052710627107271082710927110271112711227113271142711527116271172711827119271202712127122271232712427125271262712727128271292713027131271322713327134271352713627137271382713927140271412714227143271442714527146271472714827149271502715127152271532715427155271562715727158271592716027161271622716327164271652716627167271682716927170271712717227173271742717527176271772717827179271802718127182271832718427185271862718727188271892719027191271922719327194271952719627197271982719927200272012720227203272042720527206272072720827209272102721127212272132721427215272162721727218272192722027221272222722327224272252722627227272282722927230272312723227233272342723527236272372723827239272402724127242272432724427245272462724727248272492725027251272522725327254272552725627257272582725927260272612726227263272642726527266272672726827269272702727127272272732727427275272762727727278272792728027281272822728327284272852728627287272882728927290272912729227293272942729527296272972729827299273002730127302273032730427305273062730727308273092731027311273122731327314273152731627317273182731927320273212732227323273242732527326273272732827329273302733127332273332733427335273362733727338273392734027341273422734327344273452734627347273482734927350273512735227353273542735527356273572735827359273602736127362273632736427365273662736727368273692737027371273722737327374273752737627377273782737927380273812738227383273842738527386273872738827389273902739127392273932739427395273962739727398273992740027401274022740327404274052740627407274082740927410274112741227413274142741527416274172741827419274202742127422274232742427425274262742727428274292743027431274322743327434274352743627437274382743927440274412744227443274442744527446274472744827449274502745127452274532745427455274562745727458274592746027461274622746327464274652746627467274682746927470274712747227473274742747527476274772747827479274802748127482274832748427485274862748727488274892749027491274922749327494274952749627497274982749927500275012750227503275042750527506275072750827509275102751127512275132751427515275162751727518275192752027521275222752327524275252752627527275282752927530275312753227533275342753527536275372753827539275402754127542275432754427545275462754727548275492755027551275522755327554275552755627557275582755927560275612756227563275642756527566275672756827569275702757127572275732757427575275762757727578275792758027581275822758327584275852758627587275882758927590275912759227593275942759527596275972759827599276002760127602276032760427605276062760727608276092761027611276122761327614276152761627617276182761927620276212762227623276242762527626276272762827629276302763127632276332763427635276362763727638276392764027641276422764327644276452764627647276482764927650276512765227653276542765527656276572765827659276602766127662276632766427665276662766727668276692767027671276722767327674276752767627677276782767927680276812768227683276842768527686276872768827689276902769127692276932769427695276962769727698276992770027701277022770327704277052770627707277082770927710277112771227713277142771527716277172771827719277202772127722277232772427725277262772727728277292773027731277322773327734277352773627737277382773927740277412774227743277442774527746277472774827749277502775127752277532775427755277562775727758277592776027761277622776327764277652776627767277682776927770277712777227773277742777527776277772777827779277802778127782277832778427785277862778727788277892779027791277922779327794277952779627797277982779927800278012780227803278042780527806278072780827809278102781127812278132781427815278162781727818278192782027821278222782327824278252782627827278282782927830278312783227833278342783527836278372783827839278402784127842278432784427845278462784727848278492785027851278522785327854278552785627857278582785927860278612786227863278642786527866278672786827869278702787127872278732787427875278762787727878278792788027881278822788327884278852788627887278882788927890278912789227893278942789527896278972789827899279002790127902279032790427905279062790727908279092791027911279122791327914279152791627917279182791927920279212792227923279242792527926279272792827929279302793127932279332793427935279362793727938279392794027941279422794327944279452794627947279482794927950279512795227953279542795527956279572795827959279602796127962279632796427965279662796727968279692797027971279722797327974279752797627977279782797927980279812798227983279842798527986279872798827989279902799127992279932799427995279962799727998279992800028001280022800328004280052800628007280082800928010280112801228013280142801528016280172801828019280202802128022280232802428025280262802728028280292803028031280322803328034280352803628037280382803928040280412804228043280442804528046280472804828049280502805128052280532805428055280562805728058280592806028061280622806328064280652806628067280682806928070280712807228073280742807528076280772807828079280802808128082280832808428085280862808728088280892809028091280922809328094280952809628097280982809928100281012810228103281042810528106281072810828109281102811128112281132811428115281162811728118281192812028121281222812328124281252812628127281282812928130281312813228133281342813528136281372813828139281402814128142281432814428145281462814728148281492815028151281522815328154281552815628157281582815928160281612816228163281642816528166281672816828169281702817128172281732817428175281762817728178281792818028181281822818328184281852818628187281882818928190281912819228193281942819528196281972819828199282002820128202282032820428205282062820728208282092821028211282122821328214282152821628217282182821928220282212822228223282242822528226282272822828229282302823128232282332823428235282362823728238282392824028241282422824328244282452824628247282482824928250282512825228253282542825528256282572825828259282602826128262282632826428265282662826728268282692827028271282722827328274282752827628277282782827928280282812828228283282842828528286282872828828289282902829128292282932829428295282962829728298282992830028301283022830328304283052830628307283082830928310283112831228313283142831528316283172831828319283202832128322283232832428325283262832728328283292833028331283322833328334283352833628337283382833928340283412834228343283442834528346283472834828349283502835128352283532835428355283562835728358283592836028361283622836328364283652836628367283682836928370283712837228373283742837528376283772837828379283802838128382283832838428385283862838728388283892839028391283922839328394283952839628397283982839928400284012840228403284042840528406284072840828409284102841128412284132841428415284162841728418284192842028421284222842328424284252842628427284282842928430284312843228433284342843528436284372843828439284402844128442284432844428445284462844728448284492845028451284522845328454284552845628457284582845928460284612846228463284642846528466284672846828469284702847128472284732847428475284762847728478284792848028481284822848328484284852848628487284882848928490284912849228493284942849528496284972849828499285002850128502285032850428505285062850728508285092851028511285122851328514285152851628517285182851928520285212852228523285242852528526285272852828529285302853128532285332853428535285362853728538285392854028541285422854328544285452854628547285482854928550285512855228553285542855528556285572855828559285602856128562285632856428565285662856728568285692857028571285722857328574285752857628577285782857928580285812858228583285842858528586285872858828589285902859128592285932859428595285962859728598285992860028601286022860328604286052860628607286082860928610286112861228613286142861528616286172861828619286202862128622286232862428625286262862728628286292863028631286322863328634286352863628637286382863928640286412864228643286442864528646286472864828649286502865128652286532865428655286562865728658286592866028661286622866328664286652866628667286682866928670286712867228673286742867528676286772867828679286802868128682286832868428685286862868728688286892869028691286922869328694286952869628697286982869928700287012870228703287042870528706287072870828709287102871128712287132871428715287162871728718287192872028721287222872328724287252872628727287282872928730287312873228733287342873528736287372873828739287402874128742287432874428745287462874728748287492875028751287522875328754287552875628757287582875928760287612876228763287642876528766287672876828769287702877128772287732877428775287762877728778287792878028781287822878328784287852878628787287882878928790287912879228793287942879528796287972879828799288002880128802288032880428805288062880728808288092881028811288122881328814288152881628817288182881928820288212882228823288242882528826288272882828829288302883128832288332883428835288362883728838288392884028841288422884328844288452884628847288482884928850288512885228853288542885528856288572885828859288602886128862288632886428865288662886728868288692887028871288722887328874288752887628877288782887928880288812888228883288842888528886288872888828889288902889128892288932889428895288962889728898288992890028901289022890328904289052890628907289082890928910289112891228913289142891528916289172891828919289202892128922289232892428925289262892728928289292893028931289322893328934289352893628937289382893928940289412894228943289442894528946289472894828949289502895128952289532895428955289562895728958289592896028961289622896328964289652896628967289682896928970289712897228973289742897528976289772897828979289802898128982289832898428985289862898728988289892899028991289922899328994289952899628997289982899929000290012900229003290042900529006290072900829009290102901129012290132901429015290162901729018290192902029021290222902329024290252902629027290282902929030290312903229033290342903529036290372903829039290402904129042290432904429045290462904729048290492905029051290522905329054290552905629057290582905929060290612906229063290642906529066290672906829069290702907129072290732907429075290762907729078290792908029081290822908329084290852908629087290882908929090290912909229093290942909529096290972909829099291002910129102291032910429105291062910729108291092911029111291122911329114291152911629117291182911929120291212912229123291242912529126291272912829129291302913129132291332913429135291362913729138291392914029141291422914329144291452914629147291482914929150291512915229153291542915529156291572915829159291602916129162291632916429165291662916729168291692917029171291722917329174291752917629177291782917929180291812918229183291842918529186291872918829189291902919129192291932919429195291962919729198291992920029201292022920329204292052920629207292082920929210292112921229213292142921529216292172921829219292202922129222292232922429225292262922729228292292923029231292322923329234292352923629237292382923929240292412924229243292442924529246292472924829249292502925129252292532925429255292562925729258292592926029261292622926329264292652926629267292682926929270292712927229273292742927529276292772927829279292802928129282292832928429285292862928729288292892929029291292922929329294292952929629297292982929929300293012930229303293042930529306293072930829309293102931129312293132931429315293162931729318293192932029321293222932329324293252932629327293282932929330293312933229333293342933529336293372933829339293402934129342293432934429345293462934729348293492935029351293522935329354293552935629357293582935929360293612936229363293642936529366293672936829369293702937129372293732937429375293762937729378293792938029381293822938329384293852938629387293882938929390293912939229393293942939529396293972939829399294002940129402294032940429405294062940729408294092941029411294122941329414294152941629417294182941929420294212942229423294242942529426294272942829429294302943129432294332943429435294362943729438294392944029441294422944329444294452944629447294482944929450294512945229453294542945529456294572945829459294602946129462294632946429465294662946729468294692947029471294722947329474294752947629477294782947929480294812948229483294842948529486294872948829489294902949129492294932949429495294962949729498294992950029501295022950329504295052950629507295082950929510295112951229513295142951529516295172951829519295202952129522295232952429525295262952729528295292953029531295322953329534295352953629537295382953929540295412954229543295442954529546295472954829549295502955129552295532955429555295562955729558295592956029561295622956329564295652956629567295682956929570295712957229573295742957529576295772957829579295802958129582295832958429585295862958729588295892959029591295922959329594295952959629597295982959929600296012960229603296042960529606296072960829609296102961129612296132961429615296162961729618296192962029621296222962329624296252962629627296282962929630296312963229633296342963529636296372963829639296402964129642296432964429645296462964729648296492965029651296522965329654296552965629657296582965929660296612966229663296642966529666296672966829669296702967129672296732967429675296762967729678296792968029681296822968329684296852968629687296882968929690296912969229693296942969529696296972969829699297002970129702297032970429705297062970729708297092971029711297122971329714297152971629717297182971929720297212972229723297242972529726297272972829729297302973129732297332973429735297362973729738297392974029741297422974329744297452974629747297482974929750297512975229753297542975529756297572975829759297602976129762297632976429765297662976729768297692977029771297722977329774297752977629777297782977929780297812978229783297842978529786297872978829789297902979129792297932979429795297962979729798297992980029801298022980329804298052980629807298082980929810298112981229813298142981529816298172981829819298202982129822298232982429825298262982729828298292983029831298322983329834298352983629837298382983929840298412984229843298442984529846298472984829849298502985129852298532985429855298562985729858298592986029861298622986329864298652986629867298682986929870298712987229873298742987529876298772987829879298802988129882298832988429885298862988729888298892989029891298922989329894298952989629897298982989929900299012990229903299042990529906299072990829909299102991129912299132991429915299162991729918299192992029921299222992329924299252992629927299282992929930299312993229933299342993529936299372993829939299402994129942299432994429945299462994729948299492995029951299522995329954299552995629957299582995929960299612996229963299642996529966299672996829969299702997129972299732997429975299762997729978299792998029981299822998329984299852998629987299882998929990299912999229993299942999529996299972999829999300003000130002300033000430005300063000730008300093001030011300123001330014300153001630017300183001930020300213002230023300243002530026300273002830029300303003130032300333003430035300363003730038300393004030041300423004330044300453004630047300483004930050300513005230053300543005530056300573005830059300603006130062300633006430065300663006730068300693007030071300723007330074300753007630077300783007930080300813008230083300843008530086300873008830089300903009130092300933009430095300963009730098300993010030101301023010330104301053010630107301083010930110301113011230113301143011530116301173011830119301203012130122301233012430125301263012730128301293013030131301323013330134301353013630137301383013930140301413014230143301443014530146301473014830149301503015130152301533015430155301563015730158301593016030161301623016330164301653016630167301683016930170301713017230173301743017530176301773017830179301803018130182301833018430185301863018730188301893019030191301923019330194301953019630197301983019930200302013020230203302043020530206302073020830209302103021130212302133021430215302163021730218302193022030221302223022330224302253022630227302283022930230302313023230233302343023530236302373023830239302403024130242302433024430245302463024730248302493025030251302523025330254302553025630257302583025930260302613026230263302643026530266302673026830269302703027130272302733027430275302763027730278302793028030281302823028330284302853028630287302883028930290302913029230293302943029530296302973029830299303003030130302303033030430305303063030730308303093031030311303123031330314303153031630317303183031930320303213032230323303243032530326303273032830329303303033130332303333033430335303363033730338303393034030341303423034330344303453034630347303483034930350303513035230353303543035530356303573035830359303603036130362303633036430365303663036730368303693037030371303723037330374303753037630377303783037930380303813038230383303843038530386303873038830389303903039130392303933039430395303963039730398303993040030401304023040330404304053040630407304083040930410304113041230413304143041530416304173041830419304203042130422304233042430425304263042730428304293043030431304323043330434304353043630437304383043930440304413044230443304443044530446304473044830449304503045130452304533045430455304563045730458304593046030461304623046330464304653046630467304683046930470304713047230473304743047530476304773047830479304803048130482304833048430485304863048730488304893049030491304923049330494304953049630497304983049930500305013050230503305043050530506305073050830509305103051130512305133051430515305163051730518305193052030521305223052330524305253052630527305283052930530305313053230533305343053530536305373053830539305403054130542305433054430545305463054730548305493055030551305523055330554305553055630557305583055930560305613056230563305643056530566305673056830569305703057130572305733057430575305763057730578305793058030581305823058330584305853058630587305883058930590305913059230593305943059530596305973059830599306003060130602306033060430605306063060730608306093061030611306123061330614306153061630617306183061930620306213062230623306243062530626306273062830629306303063130632306333063430635306363063730638306393064030641306423064330644306453064630647306483064930650306513065230653306543065530656306573065830659306603066130662306633066430665306663066730668306693067030671306723067330674306753067630677306783067930680306813068230683306843068530686306873068830689306903069130692306933069430695306963069730698306993070030701307023070330704307053070630707307083070930710307113071230713307143071530716307173071830719307203072130722307233072430725307263072730728307293073030731307323073330734307353073630737307383073930740307413074230743307443074530746307473074830749307503075130752307533075430755307563075730758307593076030761307623076330764307653076630767307683076930770307713077230773307743077530776307773077830779307803078130782307833078430785307863078730788307893079030791307923079330794307953079630797307983079930800308013080230803308043080530806308073080830809308103081130812308133081430815308163081730818308193082030821308223082330824308253082630827308283082930830308313083230833308343083530836308373083830839308403084130842308433084430845308463084730848308493085030851308523085330854308553085630857308583085930860308613086230863308643086530866308673086830869308703087130872308733087430875308763087730878308793088030881308823088330884308853088630887308883088930890308913089230893308943089530896308973089830899309003090130902309033090430905309063090730908309093091030911309123091330914309153091630917309183091930920309213092230923309243092530926309273092830929309303093130932309333093430935309363093730938309393094030941309423094330944309453094630947309483094930950309513095230953309543095530956309573095830959309603096130962309633096430965309663096730968309693097030971309723097330974309753097630977309783097930980309813098230983309843098530986309873098830989309903099130992309933099430995309963099730998309993100031001310023100331004310053100631007310083100931010310113101231013310143101531016310173101831019310203102131022310233102431025310263102731028310293103031031310323103331034310353103631037310383103931040310413104231043310443104531046310473104831049310503105131052310533105431055310563105731058310593106031061310623106331064310653106631067310683106931070310713107231073310743107531076310773107831079310803108131082310833108431085310863108731088310893109031091310923109331094310953109631097310983109931100311013110231103311043110531106311073110831109311103111131112311133111431115311163111731118311193112031121311223112331124311253112631127311283112931130311313113231133311343113531136311373113831139311403114131142311433114431145311463114731148311493115031151311523115331154311553115631157311583115931160311613116231163311643116531166311673116831169311703117131172311733117431175311763117731178311793118031181311823118331184311853118631187311883118931190311913119231193311943119531196311973119831199312003120131202312033120431205312063120731208312093121031211312123121331214312153121631217312183121931220312213122231223312243122531226312273122831229312303123131232312333123431235312363123731238312393124031241312423124331244312453124631247312483124931250312513125231253312543125531256312573125831259312603126131262312633126431265312663126731268312693127031271312723127331274312753127631277312783127931280312813128231283312843128531286312873128831289312903129131292312933129431295312963129731298312993130031301313023130331304313053130631307313083130931310313113131231313313143131531316313173131831319313203132131322313233132431325313263132731328313293133031331313323133331334313353133631337313383133931340313413134231343313443134531346313473134831349313503135131352313533135431355313563135731358313593136031361313623136331364313653136631367313683136931370313713137231373313743137531376313773137831379313803138131382313833138431385313863138731388313893139031391313923139331394313953139631397313983139931400314013140231403314043140531406314073140831409314103141131412314133141431415314163141731418314193142031421314223142331424314253142631427314283142931430314313143231433314343143531436314373143831439314403144131442314433144431445314463144731448314493145031451314523145331454314553145631457314583145931460314613146231463314643146531466314673146831469314703147131472314733147431475314763147731478314793148031481314823148331484314853148631487314883148931490314913149231493314943149531496314973149831499315003150131502315033150431505315063150731508315093151031511315123151331514315153151631517315183151931520315213152231523315243152531526315273152831529315303153131532315333153431535315363153731538315393154031541315423154331544315453154631547315483154931550315513155231553315543155531556315573155831559315603156131562315633156431565315663156731568315693157031571315723157331574315753157631577315783157931580315813158231583315843158531586315873158831589315903159131592315933159431595315963159731598315993160031601316023160331604316053160631607316083160931610316113161231613316143161531616316173161831619316203162131622316233162431625316263162731628316293163031631316323163331634316353163631637316383163931640316413164231643316443164531646316473164831649316503165131652316533165431655316563165731658316593166031661316623166331664316653166631667316683166931670316713167231673316743167531676316773167831679316803168131682316833168431685316863168731688316893169031691316923169331694316953169631697316983169931700317013170231703317043170531706317073170831709317103171131712317133171431715317163171731718317193172031721317223172331724317253172631727317283172931730317313173231733317343173531736317373173831739317403174131742317433174431745317463174731748317493175031751317523175331754317553175631757317583175931760317613176231763317643176531766317673176831769317703177131772317733177431775317763177731778317793178031781317823178331784317853178631787317883178931790317913179231793317943179531796317973179831799318003180131802318033180431805318063180731808318093181031811318123181331814318153181631817318183181931820318213182231823318243182531826318273182831829318303183131832318333183431835318363183731838318393184031841318423184331844318453184631847318483184931850318513185231853318543185531856318573185831859318603186131862318633186431865318663186731868318693187031871318723187331874318753187631877318783187931880318813188231883318843188531886318873188831889318903189131892318933189431895318963189731898318993190031901319023190331904319053190631907319083190931910319113191231913319143191531916319173191831919319203192131922319233192431925319263192731928319293193031931319323193331934319353193631937319383193931940319413194231943319443194531946319473194831949319503195131952319533195431955319563195731958319593196031961319623196331964319653196631967319683196931970319713197231973319743197531976319773197831979319803198131982319833198431985319863198731988319893199031991319923199331994319953199631997319983199932000320013200232003320043200532006320073200832009320103201132012320133201432015320163201732018320193202032021320223202332024320253202632027320283202932030320313203232033320343203532036320373203832039320403204132042320433204432045320463204732048320493205032051320523205332054320553205632057320583205932060320613206232063320643206532066320673206832069320703207132072320733207432075320763207732078320793208032081320823208332084320853208632087320883208932090320913209232093320943209532096320973209832099321003210132102321033210432105321063210732108321093211032111321123211332114321153211632117321183211932120321213212232123321243212532126321273212832129321303213132132321333213432135321363213732138321393214032141321423214332144321453214632147321483214932150321513215232153321543215532156321573215832159321603216132162321633216432165321663216732168321693217032171321723217332174321753217632177321783217932180321813218232183321843218532186321873218832189321903219132192321933219432195321963219732198321993220032201322023220332204322053220632207322083220932210322113221232213322143221532216322173221832219322203222132222322233222432225322263222732228322293223032231322323223332234322353223632237322383223932240322413224232243322443224532246322473224832249322503225132252322533225432255322563225732258322593226032261322623226332264322653226632267322683226932270322713227232273322743227532276322773227832279322803228132282322833228432285322863228732288322893229032291322923229332294322953229632297322983229932300323013230232303323043230532306323073230832309323103231132312323133231432315323163231732318323193232032321323223232332324323253232632327323283232932330323313233232333323343233532336323373233832339323403234132342323433234432345323463234732348323493235032351323523235332354323553235632357323583235932360323613236232363323643236532366323673236832369323703237132372323733237432375323763237732378323793238032381323823238332384323853238632387323883238932390323913239232393323943239532396323973239832399324003240132402324033240432405324063240732408324093241032411324123241332414324153241632417324183241932420324213242232423324243242532426324273242832429324303243132432324333243432435324363243732438324393244032441324423244332444324453244632447324483244932450324513245232453324543245532456324573245832459324603246132462324633246432465324663246732468324693247032471324723247332474324753247632477324783247932480324813248232483324843248532486324873248832489324903249132492324933249432495324963249732498324993250032501325023250332504325053250632507325083250932510325113251232513325143251532516325173251832519325203252132522325233252432525325263252732528325293253032531325323253332534325353253632537325383253932540325413254232543325443254532546325473254832549325503255132552325533255432555325563255732558325593256032561325623256332564325653256632567325683256932570325713257232573325743257532576325773257832579325803258132582325833258432585325863258732588325893259032591325923259332594325953259632597325983259932600326013260232603326043260532606326073260832609326103261132612326133261432615326163261732618326193262032621326223262332624326253262632627326283262932630326313263232633326343263532636326373263832639326403264132642326433264432645326463264732648326493265032651326523265332654326553265632657326583265932660326613266232663326643266532666326673266832669326703267132672326733267432675326763267732678326793268032681326823268332684326853268632687326883268932690326913269232693326943269532696326973269832699327003270132702327033270432705327063270732708327093271032711327123271332714327153271632717327183271932720327213272232723327243272532726327273272832729327303273132732327333273432735327363273732738327393274032741327423274332744327453274632747327483274932750327513275232753327543275532756327573275832759327603276132762327633276432765327663276732768327693277032771327723277332774327753277632777327783277932780327813278232783327843278532786327873278832789327903279132792327933279432795327963279732798327993280032801328023280332804328053280632807328083280932810328113281232813328143281532816328173281832819328203282132822328233282432825328263282732828328293283032831328323283332834328353283632837328383283932840328413284232843328443284532846328473284832849328503285132852328533285432855328563285732858328593286032861328623286332864328653286632867328683286932870328713287232873328743287532876328773287832879328803288132882328833288432885328863288732888328893289032891328923289332894328953289632897328983289932900329013290232903329043290532906329073290832909329103291132912329133291432915329163291732918329193292032921329223292332924329253292632927329283292932930329313293232933329343293532936329373293832939329403294132942329433294432945329463294732948329493295032951329523295332954329553295632957329583295932960329613296232963329643296532966329673296832969329703297132972329733297432975329763297732978329793298032981329823298332984329853298632987329883298932990329913299232993329943299532996329973299832999330003300133002330033300433005330063300733008330093301033011330123301333014330153301633017330183301933020330213302233023330243302533026330273302833029330303303133032330333303433035330363303733038330393304033041330423304333044330453304633047330483304933050330513305233053330543305533056330573305833059330603306133062330633306433065330663306733068330693307033071330723307333074330753307633077330783307933080330813308233083330843308533086330873308833089330903309133092330933309433095330963309733098330993310033101331023310333104331053310633107331083310933110331113311233113331143311533116331173311833119331203312133122331233312433125331263312733128331293313033131331323313333134331353313633137331383313933140331413314233143331443314533146331473314833149331503315133152331533315433155331563315733158331593316033161331623316333164331653316633167331683316933170331713317233173331743317533176331773317833179331803318133182331833318433185331863318733188331893319033191331923319333194331953319633197331983319933200332013320233203332043320533206332073320833209332103321133212332133321433215332163321733218332193322033221332223322333224332253322633227332283322933230332313323233233332343323533236332373323833239332403324133242332433324433245332463324733248332493325033251332523325333254332553325633257332583325933260332613326233263332643326533266332673326833269332703327133272332733327433275332763327733278332793328033281332823328333284332853328633287332883328933290332913329233293332943329533296332973329833299333003330133302333033330433305333063330733308333093331033311333123331333314333153331633317333183331933320333213332233323333243332533326333273332833329333303333133332333333333433335333363333733338333393334033341333423334333344333453334633347333483334933350333513335233353333543335533356333573335833359333603336133362333633336433365333663336733368333693337033371333723337333374333753337633377333783337933380333813338233383333843338533386333873338833389333903339133392333933339433395333963339733398333993340033401334023340333404334053340633407334083340933410334113341233413334143341533416334173341833419334203342133422334233342433425334263342733428334293343033431334323343333434334353343633437334383343933440334413344233443334443344533446334473344833449334503345133452334533345433455334563345733458334593346033461334623346333464334653346633467334683346933470334713347233473334743347533476334773347833479334803348133482334833348433485334863348733488334893349033491334923349333494334953349633497334983349933500335013350233503335043350533506335073350833509335103351133512335133351433515335163351733518335193352033521335223352333524335253352633527335283352933530335313353233533335343353533536335373353833539335403354133542335433354433545335463354733548335493355033551335523355333554335553355633557335583355933560335613356233563335643356533566335673356833569335703357133572335733357433575335763357733578335793358033581335823358333584335853358633587335883358933590335913359233593335943359533596335973359833599336003360133602336033360433605336063360733608336093361033611336123361333614336153361633617336183361933620336213362233623336243362533626336273362833629336303363133632336333363433635336363363733638336393364033641336423364333644336453364633647336483364933650336513365233653336543365533656336573365833659336603366133662336633366433665336663366733668336693367033671336723367333674336753367633677336783367933680336813368233683336843368533686336873368833689336903369133692336933369433695336963369733698336993370033701337023370333704337053370633707337083370933710337113371233713337143371533716337173371833719337203372133722337233372433725337263372733728337293373033731337323373333734337353373633737337383373933740337413374233743337443374533746337473374833749337503375133752337533375433755337563375733758337593376033761337623376333764337653376633767337683376933770337713377233773337743377533776337773377833779337803378133782337833378433785337863378733788337893379033791337923379333794337953379633797337983379933800338013380233803338043380533806338073380833809338103381133812338133381433815338163381733818338193382033821338223382333824338253382633827338283382933830338313383233833338343383533836338373383833839338403384133842338433384433845338463384733848338493385033851338523385333854338553385633857338583385933860338613386233863338643386533866338673386833869338703387133872338733387433875338763387733878338793388033881338823388333884338853388633887338883388933890338913389233893338943389533896338973389833899339003390133902339033390433905339063390733908339093391033911339123391333914339153391633917339183391933920339213392233923339243392533926339273392833929339303393133932339333393433935339363393733938339393394033941339423394333944339453394633947339483394933950339513395233953339543395533956339573395833959339603396133962339633396433965339663396733968339693397033971339723397333974339753397633977339783397933980339813398233983339843398533986339873398833989339903399133992339933399433995339963399733998339993400034001340023400334004340053400634007340083400934010340113401234013340143401534016340173401834019340203402134022340233402434025340263402734028340293403034031340323403334034340353403634037340383403934040340413404234043340443404534046340473404834049340503405134052340533405434055340563405734058340593406034061340623406334064340653406634067340683406934070340713407234073340743407534076340773407834079340803408134082340833408434085340863408734088340893409034091340923409334094340953409634097340983409934100341013410234103341043410534106341073410834109341103411134112341133411434115341163411734118341193412034121341223412334124341253412634127341283412934130341313413234133341343413534136341373413834139341403414134142341433414434145341463414734148341493415034151341523415334154341553415634157341583415934160341613416234163341643416534166341673416834169341703417134172341733417434175341763417734178341793418034181341823418334184341853418634187341883418934190341913419234193341943419534196341973419834199342003420134202342033420434205342063420734208342093421034211342123421334214342153421634217342183421934220342213422234223342243422534226342273422834229342303423134232342333423434235342363423734238342393424034241342423424334244342453424634247342483424934250342513425234253342543425534256342573425834259342603426134262342633426434265342663426734268342693427034271342723427334274342753427634277342783427934280342813428234283342843428534286342873428834289342903429134292342933429434295342963429734298342993430034301343023430334304343053430634307343083430934310343113431234313343143431534316343173431834319343203432134322343233432434325343263432734328343293433034331343323433334334343353433634337343383433934340343413434234343343443434534346343473434834349343503435134352343533435434355343563435734358343593436034361343623436334364343653436634367343683436934370343713437234373343743437534376343773437834379343803438134382343833438434385343863438734388343893439034391343923439334394343953439634397343983439934400344013440234403344043440534406344073440834409344103441134412344133441434415344163441734418344193442034421344223442334424344253442634427344283442934430344313443234433344343443534436344373443834439344403444134442344433444434445344463444734448344493445034451344523445334454344553445634457344583445934460344613446234463344643446534466344673446834469344703447134472344733447434475344763447734478344793448034481344823448334484344853448634487344883448934490344913449234493344943449534496344973449834499345003450134502345033450434505345063450734508345093451034511345123451334514345153451634517345183451934520345213452234523345243452534526345273452834529345303453134532345333453434535345363453734538345393454034541345423454334544345453454634547345483454934550345513455234553345543455534556345573455834559345603456134562345633456434565345663456734568345693457034571345723457334574345753457634577345783457934580345813458234583345843458534586345873458834589345903459134592345933459434595345963459734598345993460034601346023460334604346053460634607346083460934610346113461234613346143461534616346173461834619346203462134622346233462434625346263462734628346293463034631346323463334634346353463634637346383463934640346413464234643346443464534646346473464834649346503465134652346533465434655346563465734658346593466034661346623466334664346653466634667346683466934670346713467234673346743467534676346773467834679346803468134682346833468434685346863468734688346893469034691346923469334694346953469634697346983469934700347013470234703347043470534706347073470834709347103471134712347133471434715347163471734718347193472034721347223472334724347253472634727347283472934730347313473234733347343473534736347373473834739347403474134742347433474434745347463474734748347493475034751347523475334754347553475634757347583475934760347613476234763347643476534766347673476834769347703477134772347733477434775347763477734778347793478034781347823478334784347853478634787347883478934790347913479234793347943479534796347973479834799348003480134802348033480434805348063480734808348093481034811348123481334814348153481634817348183481934820348213482234823348243482534826348273482834829348303483134832348333483434835348363483734838348393484034841348423484334844348453484634847348483484934850348513485234853348543485534856348573485834859348603486134862348633486434865348663486734868348693487034871348723487334874348753487634877348783487934880348813488234883348843488534886348873488834889348903489134892348933489434895348963489734898348993490034901349023490334904349053490634907349083490934910349113491234913349143491534916349173491834919349203492134922349233492434925349263492734928349293493034931349323493334934349353493634937349383493934940349413494234943349443494534946349473494834949349503495134952349533495434955349563495734958349593496034961349623496334964349653496634967349683496934970349713497234973349743497534976349773497834979349803498134982349833498434985349863498734988349893499034991349923499334994349953499634997349983499935000350013500235003350043500535006350073500835009350103501135012350133501435015350163501735018350193502035021350223502335024350253502635027350283502935030350313503235033350343503535036350373503835039350403504135042350433504435045350463504735048350493505035051350523505335054350553505635057350583505935060350613506235063350643506535066350673506835069350703507135072350733507435075350763507735078350793508035081350823508335084350853508635087350883508935090350913509235093350943509535096350973509835099351003510135102351033510435105351063510735108351093511035111351123511335114351153511635117351183511935120351213512235123351243512535126351273512835129351303513135132351333513435135351363513735138351393514035141351423514335144351453514635147351483514935150351513515235153351543515535156351573515835159351603516135162351633516435165351663516735168351693517035171351723517335174351753517635177351783517935180351813518235183351843518535186351873518835189351903519135192351933519435195351963519735198351993520035201352023520335204352053520635207352083520935210352113521235213352143521535216352173521835219352203522135222352233522435225352263522735228352293523035231352323523335234352353523635237352383523935240352413524235243352443524535246352473524835249352503525135252352533525435255352563525735258352593526035261352623526335264352653526635267352683526935270352713527235273352743527535276352773527835279352803528135282352833528435285352863528735288352893529035291352923529335294352953529635297352983529935300353013530235303353043530535306353073530835309353103531135312353133531435315353163531735318353193532035321353223532335324353253532635327353283532935330353313533235333353343533535336353373533835339353403534135342353433534435345353463534735348353493535035351353523535335354353553535635357353583535935360353613536235363353643536535366353673536835369353703537135372353733537435375353763537735378353793538035381353823538335384353853538635387353883538935390353913539235393353943539535396353973539835399354003540135402354033540435405354063540735408354093541035411354123541335414354153541635417354183541935420354213542235423354243542535426354273542835429354303543135432354333543435435354363543735438354393544035441354423544335444354453544635447354483544935450354513545235453354543545535456354573545835459354603546135462354633546435465354663546735468354693547035471354723547335474354753547635477354783547935480354813548235483354843548535486354873548835489354903549135492354933549435495354963549735498354993550035501355023550335504355053550635507355083550935510355113551235513355143551535516355173551835519355203552135522355233552435525355263552735528355293553035531355323553335534355353553635537355383553935540355413554235543355443554535546355473554835549355503555135552355533555435555355563555735558355593556035561355623556335564355653556635567355683556935570355713557235573355743557535576355773557835579355803558135582355833558435585355863558735588355893559035591355923559335594355953559635597355983559935600356013560235603356043560535606356073560835609356103561135612356133561435615356163561735618356193562035621356223562335624356253562635627356283562935630356313563235633356343563535636356373563835639356403564135642356433564435645356463564735648356493565035651356523565335654356553565635657356583565935660356613566235663356643566535666356673566835669356703567135672356733567435675356763567735678356793568035681356823568335684356853568635687356883568935690356913569235693356943569535696356973569835699357003570135702357033570435705357063570735708357093571035711357123571335714357153571635717357183571935720357213572235723357243572535726357273572835729357303573135732357333573435735357363573735738357393574035741357423574335744357453574635747357483574935750357513575235753357543575535756357573575835759357603576135762357633576435765357663576735768357693577035771357723577335774357753577635777357783577935780357813578235783357843578535786357873578835789357903579135792357933579435795357963579735798357993580035801358023580335804358053580635807358083580935810358113581235813358143581535816358173581835819358203582135822358233582435825358263582735828358293583035831358323583335834358353583635837358383583935840358413584235843358443584535846358473584835849358503585135852358533585435855358563585735858358593586035861358623586335864358653586635867358683586935870358713587235873358743587535876358773587835879358803588135882358833588435885358863588735888358893589035891358923589335894358953589635897358983589935900359013590235903359043590535906359073590835909359103591135912359133591435915359163591735918359193592035921359223592335924359253592635927359283592935930359313593235933359343593535936359373593835939359403594135942359433594435945359463594735948359493595035951359523595335954359553595635957359583595935960359613596235963359643596535966359673596835969359703597135972359733597435975359763597735978359793598035981359823598335984359853598635987359883598935990359913599235993359943599535996359973599835999360003600136002360033600436005360063600736008360093601036011360123601336014360153601636017360183601936020360213602236023360243602536026360273602836029360303603136032360333603436035360363603736038360393604036041360423604336044360453604636047360483604936050360513605236053360543605536056360573605836059360603606136062360633606436065360663606736068360693607036071360723607336074360753607636077360783607936080360813608236083360843608536086360873608836089360903609136092360933609436095360963609736098360993610036101361023610336104361053610636107361083610936110361113611236113361143611536116361173611836119361203612136122361233612436125361263612736128361293613036131361323613336134361353613636137361383613936140361413614236143361443614536146361473614836149361503615136152361533615436155361563615736158361593616036161361623616336164361653616636167361683616936170361713617236173361743617536176361773617836179361803618136182361833618436185361863618736188361893619036191361923619336194361953619636197361983619936200362013620236203362043620536206362073620836209362103621136212362133621436215362163621736218362193622036221362223622336224362253622636227362283622936230362313623236233362343623536236362373623836239362403624136242362433624436245362463624736248362493625036251362523625336254362553625636257362583625936260362613626236263362643626536266362673626836269362703627136272362733627436275362763627736278362793628036281362823628336284362853628636287362883628936290362913629236293362943629536296362973629836299363003630136302363033630436305363063630736308363093631036311363123631336314363153631636317363183631936320363213632236323363243632536326363273632836329363303633136332363333633436335363363633736338363393634036341363423634336344363453634636347363483634936350363513635236353363543635536356363573635836359363603636136362363633636436365363663636736368363693637036371363723637336374363753637636377363783637936380363813638236383363843638536386363873638836389363903639136392363933639436395363963639736398363993640036401364023640336404364053640636407364083640936410364113641236413364143641536416364173641836419364203642136422364233642436425364263642736428364293643036431364323643336434364353643636437364383643936440364413644236443364443644536446364473644836449364503645136452364533645436455364563645736458364593646036461364623646336464364653646636467364683646936470364713647236473364743647536476364773647836479364803648136482364833648436485364863648736488364893649036491364923649336494364953649636497364983649936500365013650236503365043650536506365073650836509365103651136512365133651436515365163651736518365193652036521365223652336524365253652636527365283652936530365313653236533365343653536536365373653836539365403654136542365433654436545365463654736548365493655036551365523655336554365553655636557365583655936560365613656236563365643656536566365673656836569365703657136572365733657436575365763657736578365793658036581365823658336584365853658636587365883658936590365913659236593365943659536596365973659836599366003660136602366033660436605366063660736608366093661036611366123661336614366153661636617366183661936620366213662236623366243662536626366273662836629366303663136632366333663436635366363663736638366393664036641366423664336644366453664636647366483664936650366513665236653366543665536656366573665836659366603666136662366633666436665366663666736668366693667036671366723667336674366753667636677366783667936680366813668236683366843668536686366873668836689366903669136692366933669436695366963669736698366993670036701367023670336704367053670636707367083670936710367113671236713367143671536716367173671836719367203672136722367233672436725367263672736728367293673036731367323673336734367353673636737367383673936740367413674236743367443674536746367473674836749367503675136752367533675436755367563675736758367593676036761367623676336764367653676636767367683676936770367713677236773367743677536776367773677836779367803678136782367833678436785367863678736788367893679036791367923679336794367953679636797367983679936800368013680236803368043680536806368073680836809368103681136812368133681436815368163681736818368193682036821368223682336824368253682636827368283682936830368313683236833368343683536836368373683836839368403684136842368433684436845368463684736848368493685036851368523685336854368553685636857368583685936860368613686236863368643686536866368673686836869368703687136872368733687436875368763687736878368793688036881368823688336884368853688636887368883688936890368913689236893368943689536896368973689836899369003690136902369033690436905369063690736908369093691036911369123691336914369153691636917369183691936920369213692236923369243692536926369273692836929369303693136932369333693436935369363693736938369393694036941369423694336944369453694636947369483694936950369513695236953369543695536956369573695836959369603696136962369633696436965369663696736968369693697036971369723697336974369753697636977369783697936980369813698236983369843698536986369873698836989369903699136992369933699436995369963699736998369993700037001370023700337004370053700637007370083700937010370113701237013370143701537016370173701837019370203702137022370233702437025370263702737028370293703037031370323703337034370353703637037370383703937040370413704237043370443704537046370473704837049370503705137052370533705437055370563705737058370593706037061370623706337064370653706637067370683706937070370713707237073370743707537076370773707837079370803708137082370833708437085370863708737088370893709037091370923709337094370953709637097370983709937100371013710237103371043710537106371073710837109371103711137112371133711437115371163711737118371193712037121371223712337124371253712637127371283712937130371313713237133371343713537136371373713837139371403714137142371433714437145371463714737148371493715037151371523715337154371553715637157371583715937160371613716237163371643716537166371673716837169371703717137172371733717437175371763717737178371793718037181371823718337184371853718637187371883718937190371913719237193371943719537196371973719837199372003720137202372033720437205372063720737208372093721037211372123721337214372153721637217372183721937220372213722237223372243722537226372273722837229372303723137232372333723437235372363723737238372393724037241372423724337244372453724637247372483724937250372513725237253372543725537256372573725837259372603726137262372633726437265372663726737268372693727037271372723727337274372753727637277372783727937280372813728237283372843728537286372873728837289372903729137292372933729437295372963729737298372993730037301373023730337304373053730637307373083730937310373113731237313373143731537316373173731837319373203732137322373233732437325373263732737328373293733037331373323733337334373353733637337373383733937340373413734237343373443734537346373473734837349373503735137352373533735437355373563735737358373593736037361373623736337364373653736637367373683736937370373713737237373373743737537376373773737837379373803738137382373833738437385373863738737388373893739037391373923739337394373953739637397373983739937400374013740237403374043740537406374073740837409374103741137412374133741437415374163741737418374193742037421374223742337424374253742637427374283742937430374313743237433374343743537436374373743837439374403744137442374433744437445374463744737448374493745037451374523745337454374553745637457374583745937460374613746237463374643746537466374673746837469374703747137472374733747437475374763747737478374793748037481374823748337484374853748637487374883748937490374913749237493374943749537496374973749837499375003750137502375033750437505375063750737508375093751037511375123751337514375153751637517375183751937520375213752237523375243752537526375273752837529375303753137532375333753437535375363753737538375393754037541375423754337544375453754637547375483754937550375513755237553375543755537556375573755837559375603756137562375633756437565375663756737568375693757037571375723757337574375753757637577375783757937580375813758237583375843758537586375873758837589375903759137592375933759437595375963759737598375993760037601376023760337604376053760637607376083760937610376113761237613376143761537616376173761837619376203762137622376233762437625376263762737628376293763037631376323763337634376353763637637376383763937640376413764237643376443764537646376473764837649376503765137652376533765437655376563765737658376593766037661376623766337664376653766637667376683766937670376713767237673376743767537676376773767837679376803768137682376833768437685376863768737688376893769037691376923769337694376953769637697376983769937700377013770237703377043770537706377073770837709377103771137712377133771437715377163771737718377193772037721377223772337724377253772637727377283772937730377313773237733377343773537736377373773837739377403774137742377433774437745377463774737748377493775037751377523775337754377553775637757377583775937760377613776237763377643776537766377673776837769377703777137772377733777437775377763777737778377793778037781377823778337784377853778637787377883778937790377913779237793377943779537796377973779837799378003780137802378033780437805378063780737808378093781037811378123781337814378153781637817378183781937820378213782237823378243782537826378273782837829378303783137832378333783437835378363783737838378393784037841378423784337844378453784637847378483784937850378513785237853378543785537856378573785837859378603786137862378633786437865378663786737868378693787037871378723787337874378753787637877378783787937880378813788237883378843788537886378873788837889378903789137892378933789437895378963789737898378993790037901379023790337904379053790637907379083790937910379113791237913379143791537916379173791837919379203792137922379233792437925379263792737928379293793037931379323793337934379353793637937379383793937940379413794237943379443794537946379473794837949379503795137952379533795437955379563795737958379593796037961379623796337964379653796637967379683796937970379713797237973379743797537976379773797837979379803798137982379833798437985379863798737988379893799037991379923799337994379953799637997379983799938000380013800238003380043800538006380073800838009380103801138012380133801438015380163801738018380193802038021380223802338024380253802638027380283802938030380313803238033380343803538036380373803838039380403804138042380433804438045380463804738048380493805038051380523805338054380553805638057380583805938060380613806238063380643806538066380673806838069380703807138072380733807438075380763807738078380793808038081380823808338084380853808638087380883808938090380913809238093380943809538096380973809838099381003810138102381033810438105381063810738108381093811038111381123811338114381153811638117381183811938120381213812238123381243812538126381273812838129381303813138132381333813438135381363813738138381393814038141381423814338144381453814638147381483814938150381513815238153381543815538156381573815838159381603816138162381633816438165381663816738168381693817038171381723817338174381753817638177381783817938180381813818238183381843818538186381873818838189381903819138192381933819438195381963819738198381993820038201382023820338204382053820638207382083820938210382113821238213382143821538216382173821838219382203822138222382233822438225382263822738228382293823038231382323823338234382353823638237382383823938240382413824238243382443824538246382473824838249382503825138252382533825438255382563825738258382593826038261382623826338264382653826638267382683826938270382713827238273382743827538276382773827838279382803828138282382833828438285382863828738288382893829038291382923829338294382953829638297382983829938300383013830238303383043830538306383073830838309383103831138312383133831438315383163831738318383193832038321383223832338324383253832638327383283832938330383313833238333383343833538336383373833838339383403834138342383433834438345383463834738348383493835038351383523835338354383553835638357383583835938360383613836238363383643836538366383673836838369383703837138372383733837438375383763837738378383793838038381383823838338384383853838638387383883838938390383913839238393383943839538396383973839838399384003840138402384033840438405384063840738408384093841038411384123841338414384153841638417384183841938420384213842238423384243842538426384273842838429384303843138432384333843438435384363843738438384393844038441384423844338444384453844638447384483844938450384513845238453384543845538456384573845838459384603846138462384633846438465384663846738468384693847038471384723847338474384753847638477384783847938480384813848238483384843848538486384873848838489384903849138492384933849438495384963849738498384993850038501385023850338504385053850638507385083850938510385113851238513385143851538516385173851838519385203852138522385233852438525385263852738528385293853038531385323853338534385353853638537385383853938540385413854238543385443854538546385473854838549385503855138552385533855438555385563855738558385593856038561385623856338564385653856638567385683856938570385713857238573385743857538576385773857838579385803858138582385833858438585385863858738588385893859038591385923859338594385953859638597385983859938600386013860238603386043860538606386073860838609386103861138612386133861438615386163861738618386193862038621386223862338624386253862638627386283862938630386313863238633386343863538636386373863838639386403864138642386433864438645386463864738648386493865038651386523865338654386553865638657386583865938660386613866238663386643866538666386673866838669386703867138672386733867438675386763867738678386793868038681386823868338684386853868638687386883868938690386913869238693386943869538696386973869838699387003870138702387033870438705387063870738708387093871038711387123871338714387153871638717387183871938720387213872238723387243872538726387273872838729387303873138732387333873438735387363873738738387393874038741387423874338744387453874638747387483874938750387513875238753387543875538756387573875838759387603876138762387633876438765387663876738768387693877038771387723877338774387753877638777387783877938780387813878238783387843878538786387873878838789387903879138792387933879438795387963879738798387993880038801388023880338804388053880638807388083880938810388113881238813388143881538816388173881838819388203882138822388233882438825388263882738828388293883038831388323883338834388353883638837388383883938840388413884238843388443884538846388473884838849388503885138852388533885438855388563885738858388593886038861388623886338864388653886638867388683886938870388713887238873388743887538876388773887838879388803888138882388833888438885388863888738888388893889038891388923889338894388953889638897388983889938900389013890238903389043890538906389073890838909389103891138912389133891438915389163891738918389193892038921389223892338924389253892638927389283892938930389313893238933389343893538936389373893838939389403894138942389433894438945389463894738948389493895038951389523895338954389553895638957389583895938960389613896238963389643896538966389673896838969389703897138972389733897438975389763897738978389793898038981389823898338984389853898638987389883898938990389913899238993389943899538996389973899838999390003900139002390033900439005390063900739008390093901039011390123901339014390153901639017390183901939020390213902239023390243902539026390273902839029390303903139032390333903439035390363903739038390393904039041390423904339044390453904639047390483904939050390513905239053390543905539056390573905839059390603906139062390633906439065390663906739068390693907039071390723907339074390753907639077390783907939080390813908239083390843908539086390873908839089390903909139092390933909439095390963909739098390993910039101391023910339104391053910639107391083910939110391113911239113391143911539116391173911839119391203912139122391233912439125391263912739128391293913039131391323913339134391353913639137391383913939140391413914239143391443914539146391473914839149391503915139152391533915439155391563915739158391593916039161391623916339164391653916639167391683916939170391713917239173391743917539176391773917839179391803918139182391833918439185391863918739188391893919039191391923919339194391953919639197391983919939200392013920239203392043920539206392073920839209392103921139212392133921439215392163921739218392193922039221392223922339224392253922639227392283922939230392313923239233392343923539236392373923839239392403924139242392433924439245392463924739248392493925039251392523925339254392553925639257392583925939260392613926239263392643926539266392673926839269392703927139272392733927439275392763927739278392793928039281392823928339284392853928639287392883928939290392913929239293392943929539296392973929839299393003930139302393033930439305393063930739308393093931039311393123931339314393153931639317393183931939320393213932239323393243932539326393273932839329393303933139332393333933439335393363933739338393393934039341393423934339344393453934639347393483934939350393513935239353393543935539356393573935839359393603936139362393633936439365393663936739368393693937039371393723937339374393753937639377393783937939380393813938239383393843938539386393873938839389393903939139392393933939439395393963939739398393993940039401394023940339404394053940639407394083940939410394113941239413394143941539416394173941839419394203942139422394233942439425394263942739428394293943039431394323943339434394353943639437394383943939440394413944239443394443944539446394473944839449394503945139452394533945439455394563945739458394593946039461394623946339464394653946639467394683946939470394713947239473394743947539476394773947839479394803948139482394833948439485394863948739488394893949039491394923949339494394953949639497394983949939500395013950239503395043950539506395073950839509395103951139512395133951439515395163951739518395193952039521395223952339524395253952639527395283952939530395313953239533395343953539536395373953839539395403954139542395433954439545395463954739548395493955039551395523955339554395553955639557395583955939560395613956239563395643956539566395673956839569395703957139572395733957439575395763957739578395793958039581395823958339584395853958639587395883958939590395913959239593395943959539596395973959839599396003960139602396033960439605396063960739608396093961039611396123961339614396153961639617396183961939620396213962239623396243962539626396273962839629396303963139632396333963439635396363963739638396393964039641396423964339644396453964639647396483964939650396513965239653396543965539656396573965839659396603966139662396633966439665396663966739668396693967039671396723967339674396753967639677396783967939680396813968239683396843968539686396873968839689396903969139692396933969439695396963969739698396993970039701397023970339704397053970639707397083970939710397113971239713397143971539716397173971839719397203972139722397233972439725397263972739728397293973039731397323973339734397353973639737397383973939740397413974239743397443974539746397473974839749397503975139752397533975439755397563975739758397593976039761397623976339764397653976639767397683976939770397713977239773397743977539776397773977839779397803978139782397833978439785397863978739788397893979039791397923979339794397953979639797397983979939800398013980239803398043980539806398073980839809398103981139812398133981439815398163981739818398193982039821398223982339824398253982639827398283982939830398313983239833398343983539836398373983839839398403984139842398433984439845398463984739848398493985039851398523985339854398553985639857398583985939860398613986239863398643986539866398673986839869398703987139872398733987439875398763987739878398793988039881398823988339884398853988639887398883988939890398913989239893398943989539896398973989839899399003990139902399033990439905399063990739908399093991039911399123991339914399153991639917399183991939920399213992239923399243992539926399273992839929399303993139932399333993439935399363993739938399393994039941399423994339944399453994639947399483994939950399513995239953399543995539956399573995839959399603996139962399633996439965399663996739968399693997039971399723997339974399753997639977399783997939980399813998239983399843998539986399873998839989399903999139992399933999439995399963999739998399994000040001400024000340004400054000640007400084000940010400114001240013400144001540016400174001840019400204002140022400234002440025400264002740028400294003040031400324003340034400354003640037400384003940040400414004240043400444004540046400474004840049400504005140052400534005440055400564005740058400594006040061400624006340064400654006640067400684006940070400714007240073400744007540076400774007840079400804008140082400834008440085400864008740088400894009040091400924009340094400954009640097400984009940100401014010240103401044010540106401074010840109401104011140112401134011440115401164011740118401194012040121401224012340124401254012640127401284012940130401314013240133401344013540136401374013840139401404014140142401434014440145401464014740148401494015040151401524015340154401554015640157401584015940160401614016240163401644016540166401674016840169401704017140172401734017440175401764017740178401794018040181401824018340184401854018640187401884018940190401914019240193401944019540196401974019840199402004020140202402034020440205402064020740208402094021040211402124021340214402154021640217402184021940220402214022240223402244022540226402274022840229402304023140232402334023440235402364023740238402394024040241402424024340244402454024640247402484024940250402514025240253402544025540256402574025840259402604026140262402634026440265402664026740268402694027040271402724027340274402754027640277402784027940280402814028240283402844028540286402874028840289402904029140292402934029440295402964029740298402994030040301403024030340304403054030640307403084030940310403114031240313403144031540316403174031840319403204032140322403234032440325403264032740328403294033040331403324033340334403354033640337403384033940340403414034240343403444034540346403474034840349403504035140352403534035440355403564035740358403594036040361403624036340364403654036640367403684036940370403714037240373403744037540376403774037840379403804038140382403834038440385403864038740388403894039040391403924039340394403954039640397403984039940400404014040240403404044040540406404074040840409404104041140412404134041440415404164041740418404194042040421404224042340424404254042640427404284042940430404314043240433404344043540436404374043840439404404044140442404434044440445404464044740448404494045040451404524045340454404554045640457404584045940460404614046240463404644046540466404674046840469404704047140472404734047440475404764047740478404794048040481404824048340484404854048640487404884048940490404914049240493404944049540496404974049840499405004050140502405034050440505405064050740508405094051040511405124051340514405154051640517405184051940520405214052240523405244052540526405274052840529405304053140532405334053440535405364053740538405394054040541405424054340544405454054640547405484054940550405514055240553405544055540556405574055840559405604056140562405634056440565405664056740568405694057040571405724057340574405754057640577405784057940580405814058240583405844058540586405874058840589405904059140592405934059440595405964059740598405994060040601406024060340604406054060640607406084060940610406114061240613406144061540616406174061840619406204062140622406234062440625406264062740628406294063040631406324063340634 |
- #include "il2cpp-config.h"
- #ifndef _MSC_VER
- # include <alloca.h>
- #else
- # include <malloc.h>
- #endif
- #include <cstring>
- #include <string.h>
- #include <stdio.h>
- #include <cmath>
- #include <limits>
- #include <assert.h>
- #include <stdint.h>
- #include "il2cpp-class-internals.h"
- #include "codegen/il2cpp-codegen.h"
- #include "il2cpp-object-internals.h"
- template <typename R>
- struct VirtFuncInvoker0
- {
- typedef R (*Func)(void*, const RuntimeMethod*);
- static inline R Invoke (Il2CppMethodSlot slot, RuntimeObject* obj)
- {
- const VirtualInvokeData& invokeData = il2cpp_codegen_get_virtual_invoke_data(slot, obj);
- return ((Func)invokeData.methodPtr)(obj, invokeData.method);
- }
- };
- // XLua.CSObjectWrap.UnityEngineResourcesWrap
- struct UnityEngineResourcesWrap_t3776895103;
- // XLua.ObjectTranslatorPool
- struct ObjectTranslatorPool_t158158286;
- // XLua.ObjectTranslator
- struct ObjectTranslator_t2020767555;
- // System.Type
- struct Type_t;
- // XLua.LuaDLL.lua_CSFunction
- struct lua_CSFunction_t883524059;
- // System.String
- struct String_t;
- // UnityEngine.Resources
- struct Resources_t2942265397;
- // UnityEngine.Object[]
- struct ObjectU5BU5D_t1417781964;
- // UnityEngine.Object
- struct Object_t631007953;
- // UnityEngine.ResourceRequest
- struct ResourceRequest_t3109103591;
- // UnityEngine.AsyncOperation
- struct AsyncOperation_t1445031843;
- // XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap
- struct UnityEngineSkinnedMeshRendererWrap_t4180069450;
- // UnityEngine.SkinnedMeshRenderer
- struct SkinnedMeshRenderer_t245602842;
- // UnityEngine.Mesh
- struct Mesh_t3648964284;
- // UnityEngine.Transform[]
- struct TransformU5BU5D_t807237628;
- // UnityEngine.Transform
- struct Transform_t3600365921;
- // XLua.CSObjectWrap.UnityEngineTextAssetWrap
- struct UnityEngineTextAssetWrap_t3364475192;
- // UnityEngine.TextAsset
- struct TextAsset_t3022178571;
- // System.Byte[]
- struct ByteU5BU5D_t4116647657;
- // XLua.CSObjectWrap.UnityEngineTimeWrap
- struct UnityEngineTimeWrap_t504182158;
- // UnityEngine.Time
- struct Time_t2420636075;
- // XLua.CSObjectWrap.UnityEngineTransformWrap
- struct UnityEngineTransformWrap_t3488644103;
- // System.Collections.IEnumerator
- struct IEnumerator_t1853284238;
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions>
- struct TweenerCore_3_t2944330537;
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Vector3,DG.Tweening.Plugins.Options.QuaternionOptions>
- struct TweenerCore_3_t1299559007;
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Quaternion,DG.Tweening.Plugins.Options.NoOptions>
- struct TweenerCore_3_t3785815898;
- // DG.Tweening.Tweener
- struct Tweener_t436044680;
- // DG.Tweening.Sequence
- struct Sequence_t2050373119;
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions>
- struct TweenerCore_3_t3040139253;
- // DG.Tweening.Plugins.Core.PathCore.Path
- struct Path_t3614338981;
- // UnityEngine.Vector3[]
- struct Vector3U5BU5D_t1718750761;
- // XLua.CSObjectWrap.UnityEngineVector2Wrap
- struct UnityEngineVector2Wrap_t2602506976;
- // System.IntPtr[]
- struct IntPtrU5BU5D_t4013366056;
- // System.Collections.IDictionary
- struct IDictionary_t1363984059;
- // XLua.MethodWrapsCache
- struct MethodWrapsCache_t113059333;
- // XLua.ObjectCheckers
- struct ObjectCheckers_t1922409879;
- // XLua.ObjectCasters
- struct ObjectCasters_t3722364209;
- // XLua.ObjectPool
- struct ObjectPool_t1928582859;
- // System.Collections.Generic.Dictionary`2<System.Object,System.Int32>
- struct Dictionary_2_t3384741;
- // XLua.LuaEnv
- struct LuaEnv_t2152703515;
- // XLua.StaticLuaCallbacks
- struct StaticLuaCallbacks_t3406648379;
- // System.Collections.Generic.List`1<System.Reflection.Assembly>
- struct List_1_t1279540245;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Action`1<System.IntPtr>>
- struct Dictionary_2_t3456964840;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Func`3<System.Int32,XLua.LuaEnv,XLua.LuaBase>>
- struct Dictionary_2_t1325155278;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Type>
- struct Dictionary_2_t633324528;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Boolean>
- struct Dictionary_2_t2541635029;
- // System.Reflection.MethodInfo[]
- struct MethodInfoU5BU5D_t2572182361;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Func`2<XLua.DelegateBridgeBase,System.Delegate>>
- struct Dictionary_2_t3427006295;
- // System.Collections.Generic.Dictionary`2<System.Int32,System.WeakReference>
- struct Dictionary_2_t223600047;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Int32>
- struct Dictionary_2_t1100325521;
- // System.Collections.Generic.Dictionary`2<System.Int32,System.Type>
- struct Dictionary_2_t1372658091;
- // System.Collections.Generic.HashSet`1<System.Type>
- struct HashSet_1_t1048894234;
- // System.Collections.Generic.List`1<XLua.LuaDLL.lua_CSFunction>
- struct List_1_t2355598801;
- // System.Collections.Generic.Dictionary`2<System.Type,XLua.ObjectTranslator/PushCSObject>
- struct Dictionary_2_t974727102;
- // System.Collections.Generic.Dictionary`2<System.Type,XLua.ObjectTranslator/GetCSObject>
- struct Dictionary_2_t3199299591;
- // System.Collections.Generic.Dictionary`2<System.Type,XLua.ObjectTranslator/UpdateCSObject>
- struct Dictionary_2_t2411574205;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Delegate>
- struct Dictionary_2_t3632739877;
- // XLua.ObjectTranslator/IniterAdderXLuaTestPedding
- struct IniterAdderXLuaTestPedding_t2424681114;
- // XLua.CSObjectWrap.XLua_Gen_Initer_Register__
- struct XLua_Gen_Initer_Register___t560736047;
- // System.Func`2<System.Reflection.MethodInfo,System.Boolean>
- struct Func_2_t3487522507;
- // System.Func`2<System.Reflection.MethodInfo,System.Int32>
- struct Func_2_t2046212999;
- // System.Func`2<XLua.DelegateBridgeBase,System.Delegate>
- struct Func_2_t982659231;
- // System.Func`2<System.Reflection.ParameterInfo,System.Type>
- struct Func_2_t3692615456;
- // System.Char[]
- struct CharU5BU5D_t3528271667;
- // System.Void
- struct Void_t1185182177;
- // System.Reflection.MethodInfo
- struct MethodInfo_t;
- // System.DelegateData
- struct DelegateData_t1677132599;
- // System.Action`1<UnityEngine.AsyncOperation>
- struct Action_1_t1617499438;
- // System.Collections.Generic.Dictionary`2<System.IntPtr,System.WeakReference>
- struct Dictionary_2_t3851719731;
- // System.Type[]
- struct TypeU5BU5D_t3940880105;
- // System.Reflection.MemberFilter
- struct MemberFilter_t426314064;
- // DG.Tweening.TweenCallback
- struct TweenCallback_t3727756325;
- // DG.Tweening.Plugins.Core.PathCore.CatmullRomDecoder
- struct CatmullRomDecoder_t2053048079;
- // DG.Tweening.Plugins.Core.PathCore.LinearDecoder
- struct LinearDecoder_t2708327777;
- // DG.Tweening.Plugins.Core.PathCore.CubicBezierDecoder
- struct CubicBezierDecoder_t2663863244;
- // System.Single[]
- struct SingleU5BU5D_t1444911251;
- // DG.Tweening.Plugins.Core.PathCore.ControlPoint[]
- struct ControlPointU5BU5D_t1567961855;
- // DG.Tweening.Plugins.Core.PathCore.ABSPathDecoder
- struct ABSPathDecoder_t2613982196;
- // System.IAsyncResult
- struct IAsyncResult_t767004451;
- // System.AsyncCallback
- struct AsyncCallback_t3962456242;
- // DG.Tweening.TweenCallback`1<System.Int32>
- struct TweenCallback_1_t3009965658;
- // DG.Tweening.EaseFunction
- struct EaseFunction_t3531141372;
- // System.Collections.Generic.List`1<DG.Tweening.Tween>
- struct List_1_t3814993295;
- // System.Collections.Generic.List`1<DG.Tweening.Core.ABSSequentiable>
- struct List_1_t553148457;
- // DG.Tweening.Core.DOGetter`1<UnityEngine.Quaternion>
- struct DOGetter_1_t2044724535;
- // DG.Tweening.Core.DOSetter`1<UnityEngine.Quaternion>
- struct DOSetter_1_t3352036663;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<UnityEngine.Quaternion,UnityEngine.Quaternion,DG.Tweening.Plugins.Options.NoOptions>
- struct ABSTweenPlugin_3_t3321825548;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<UnityEngine.Quaternion,UnityEngine.Vector3,DG.Tweening.Plugins.Options.QuaternionOptions>
- struct ABSTweenPlugin_3_t835568657;
- // DG.Tweening.Core.DOGetter`1<UnityEngine.Vector3>
- struct DOGetter_1_t3465109668;
- // DG.Tweening.Core.DOSetter`1<UnityEngine.Vector3>
- struct DOSetter_1_t477454500;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions>
- struct ABSTweenPlugin_3_t2576148903;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions>
- struct ABSTweenPlugin_3_t2480340187;
- extern const RuntimeType* Resources_t2942265397_0_0_0_var;
- extern RuntimeClass* Type_t_il2cpp_TypeInfo_var;
- extern RuntimeClass* UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var;
- extern RuntimeClass* lua_CSFunction_t883524059_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap___CreateInstance_m2101056957_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_Load_xlua_st__m291082337_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821_RuntimeMethod_var;
- extern String_t* _stringLiteral875055564;
- extern String_t* _stringLiteral432140041;
- extern String_t* _stringLiteral1174336103;
- extern String_t* _stringLiteral1258524496;
- extern String_t* _stringLiteral4110426868;
- extern String_t* _stringLiteral1538031842;
- extern String_t* _stringLiteral2136762679;
- extern const uint32_t UnityEngineResourcesWrap___Register_m3828081545_MetadataUsageId;
- extern RuntimeClass* Resources_t2942265397_il2cpp_TypeInfo_var;
- extern RuntimeClass* Exception_t_il2cpp_TypeInfo_var;
- extern RuntimeClass* String_t_il2cpp_TypeInfo_var;
- extern String_t* _stringLiteral632665612;
- extern String_t* _stringLiteral457645061;
- extern const uint32_t UnityEngineResourcesWrap___CreateInstance_m2101056957_MetadataUsageId;
- extern const RuntimeType* Type_t_0_0_0_var;
- extern const uint32_t UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisType_t_m2942600910_RuntimeMethod_var;
- extern String_t* _stringLiteral91211816;
- extern const uint32_t UnityEngineResourcesWrap__m_Load_xlua_st__m291082337_MetadataUsageId;
- extern String_t* _stringLiteral153056392;
- extern const uint32_t UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299_MetadataUsageId;
- extern String_t* _stringLiteral3187571305;
- extern const uint32_t UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462_MetadataUsageId;
- extern const uint32_t UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884_MetadataUsageId;
- extern const RuntimeType* Object_t631007953_0_0_0_var;
- extern RuntimeClass* Object_t631007953_il2cpp_TypeInfo_var;
- extern const uint32_t UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910_MetadataUsageId;
- extern const uint32_t UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821_MetadataUsageId;
- extern const RuntimeType* SkinnedMeshRenderer_t245602842_0_0_0_var;
- extern RuntimeClass* UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182_RuntimeMethod_var;
- extern String_t* _stringLiteral2598379935;
- extern String_t* _stringLiteral2438723531;
- extern String_t* _stringLiteral2666589067;
- extern String_t* _stringLiteral1602046325;
- extern String_t* _stringLiteral168267742;
- extern String_t* _stringLiteral2598687286;
- extern String_t* _stringLiteral437393465;
- extern String_t* _stringLiteral1549634244;
- extern String_t* _stringLiteral893705022;
- extern String_t* _stringLiteral3076283689;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap___Register_m3321147875_MetadataUsageId;
- extern RuntimeClass* SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var;
- extern String_t* _stringLiteral3094264994;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963_MetadataUsageId;
- extern const RuntimeType* Mesh_t3648964284_0_0_0_var;
- extern RuntimeClass* Mesh_t3648964284_il2cpp_TypeInfo_var;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439_MetadataUsageId;
- extern RuntimeClass* SkinQuality_t4231844520_il2cpp_TypeInfo_var;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027_MetadataUsageId;
- extern const RuntimeType* TransformU5BU5D_t807237628_0_0_0_var;
- extern RuntimeClass* TransformU5BU5D_t807237628_il2cpp_TypeInfo_var;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Get_TisSkinQuality_t4231844520_m2385978519_RuntimeMethod_var;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567_MetadataUsageId;
- extern const RuntimeType* Transform_t3600365921_0_0_0_var;
- extern RuntimeClass* Transform_t3600365921_il2cpp_TypeInfo_var;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720_MetadataUsageId;
- extern const uint32_t UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815_MetadataUsageId;
- extern const RuntimeType* TextAsset_t3022178571_0_0_0_var;
- extern RuntimeClass* UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* UnityEngineTextAssetWrap__m_ToString_m2000840227_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTextAssetWrap__g_get_text_m2083243538_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTextAssetWrap__g_get_bytes_m819075780_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTextAssetWrap___CreateInstance_m788894500_RuntimeMethod_var;
- extern String_t* _stringLiteral3020121551;
- extern String_t* _stringLiteral3987835854;
- extern String_t* _stringLiteral130595687;
- extern const uint32_t UnityEngineTextAssetWrap___Register_m2660327034_MetadataUsageId;
- extern RuntimeClass* TextAsset_t3022178571_il2cpp_TypeInfo_var;
- extern String_t* _stringLiteral851764850;
- extern const uint32_t UnityEngineTextAssetWrap___CreateInstance_m788894500_MetadataUsageId;
- extern const uint32_t UnityEngineTextAssetWrap__m_ToString_m2000840227_MetadataUsageId;
- extern const uint32_t UnityEngineTextAssetWrap__g_get_text_m2083243538_MetadataUsageId;
- extern const uint32_t UnityEngineTextAssetWrap__g_get_bytes_m819075780_MetadataUsageId;
- extern const RuntimeType* Time_t2420636075_0_0_0_var;
- extern RuntimeClass* UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* UnityEngineTimeWrap___CreateInstance_m626113703_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_time_m1863490483_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_deltaTime_m201033604_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_fixedTime_m1141309118_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_unscaledTime_m1722259242_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_timeScale_m3205244298_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_frameCount_m2155433661_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_captureFramerate_m587593122_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__s_set_timeScale_m2124012409_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTimeWrap__s_set_captureFramerate_m3614803111_RuntimeMethod_var;
- extern String_t* _stringLiteral63249541;
- extern String_t* _stringLiteral3175980615;
- extern String_t* _stringLiteral1236680008;
- extern String_t* _stringLiteral1266844689;
- extern String_t* _stringLiteral3813774167;
- extern String_t* _stringLiteral2671238855;
- extern String_t* _stringLiteral4116380890;
- extern String_t* _stringLiteral2267104746;
- extern String_t* _stringLiteral1879621273;
- extern String_t* _stringLiteral3125897083;
- extern String_t* _stringLiteral851332882;
- extern String_t* _stringLiteral2979169347;
- extern String_t* _stringLiteral1186667495;
- extern String_t* _stringLiteral207938285;
- extern String_t* _stringLiteral2873276515;
- extern String_t* _stringLiteral3848975043;
- extern String_t* _stringLiteral2234321686;
- extern String_t* _stringLiteral3514965321;
- extern const uint32_t UnityEngineTimeWrap___Register_m1297693217_MetadataUsageId;
- extern RuntimeClass* Time_t2420636075_il2cpp_TypeInfo_var;
- extern String_t* _stringLiteral3376816847;
- extern const uint32_t UnityEngineTimeWrap___CreateInstance_m626113703_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_time_m1863490483_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_deltaTime_m201033604_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_fixedTime_m1141309118_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_unscaledTime_m1722259242_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_timeScale_m3205244298_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_frameCount_m2155433661_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_captureFramerate_m587593122_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__s_set_timeScale_m2124012409_MetadataUsageId;
- extern const uint32_t UnityEngineTimeWrap__s_set_captureFramerate_m3614803111_MetadataUsageId;
- extern RuntimeClass* UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_SetParent_m804936730_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_Translate_m975680681_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_Rotate_m1066480346_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_RotateAround_m3000108533_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_LookAt_m1878060840_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_TransformDirection_m4138306096_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_TransformVector_m1514244944_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_InverseTransformVector_m1349495655_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_TransformPoint_m1078881144_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_InverseTransformPoint_m957968118_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DetachChildren_m520041245_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_Find_m1578719640_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_IsChildOf_m764668816_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_GetEnumerator_m2850786488_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_GetChild_m1976232125_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOMove_m2510464153_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOMoveX_m427706497_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOMoveY_m3829814726_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOMoveZ_m3431864067_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalMove_m602687662_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DORotate_m825617719_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalRotate_m4095437176_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOScale_m1896281278_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOScaleX_m2063790813_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOScaleY_m3874994172_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOScaleZ_m976566461_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLookAt_m89020156_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOPunchPosition_m1266900073_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOPunchScale_m2535020043_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOPunchRotation_m3158922004_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOShakePosition_m3720856662_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOShakeRotation_m241003690_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOShakeScale_m2406116869_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOJump_m4133327798_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalJump_m296616187_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOPath_m2509685622_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOLocalPath_m442715724_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_position_m2180048924_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_localPosition_m3878105019_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_eulerAngles_m3922999519_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_right_m469775628_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_up_m3208095539_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_forward_m2765842083_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_rotation_m1745653753_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_localRotation_m637984894_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_localScale_m3915212871_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_parent_m3003513812_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_root_m58896500_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_childCount_m222537369_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_lossyScale_m3129807950_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_hasChanged_m2133940418_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_position_m2248180735_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_localPosition_m572438127_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_eulerAngles_m2405101980_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_right_m1502050898_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_up_m1616193993_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_forward_m1425629139_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_rotation_m2344385924_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_localRotation_m3029152408_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_localScale_m1212933853_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_parent_m3451686420_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_hasChanged_m195551608_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineTransformWrap___CreateInstance_m1894308163_RuntimeMethod_var;
- extern String_t* _stringLiteral631211784;
- extern String_t* _stringLiteral2941355937;
- extern String_t* _stringLiteral547368030;
- extern String_t* _stringLiteral845267518;
- extern String_t* _stringLiteral316676394;
- extern String_t* _stringLiteral1944240872;
- extern String_t* _stringLiteral2632091121;
- extern String_t* _stringLiteral771426467;
- extern String_t* _stringLiteral1724311596;
- extern String_t* _stringLiteral3292596422;
- extern String_t* _stringLiteral3530984291;
- extern String_t* _stringLiteral553894831;
- extern String_t* _stringLiteral897953071;
- extern String_t* _stringLiteral904694020;
- extern String_t* _stringLiteral1184080547;
- extern String_t* _stringLiteral407814805;
- extern String_t* _stringLiteral407711105;
- extern String_t* _stringLiteral835817774;
- extern String_t* _stringLiteral3733432723;
- extern String_t* _stringLiteral3024845674;
- extern String_t* _stringLiteral797258743;
- extern String_t* _stringLiteral2952807841;
- extern String_t* _stringLiteral3451201703;
- extern String_t* _stringLiteral722318348;
- extern String_t* _stringLiteral2288402289;
- extern String_t* _stringLiteral1495791138;
- extern String_t* _stringLiteral2438985250;
- extern String_t* _stringLiteral482670114;
- extern String_t* _stringLiteral2821322274;
- extern String_t* _stringLiteral979177448;
- extern String_t* _stringLiteral894585886;
- extern String_t* _stringLiteral2997256641;
- extern String_t* _stringLiteral4072772396;
- extern String_t* _stringLiteral4241776963;
- extern String_t* _stringLiteral303849795;
- extern String_t* _stringLiteral2260164931;
- extern String_t* _stringLiteral4216480067;
- extern String_t* _stringLiteral3148468566;
- extern String_t* _stringLiteral2444761646;
- extern String_t* _stringLiteral2664994817;
- extern String_t* _stringLiteral320213078;
- extern String_t* _stringLiteral4197268947;
- extern String_t* _stringLiteral967657387;
- extern String_t* _stringLiteral1601687253;
- extern String_t* _stringLiteral972089301;
- extern String_t* _stringLiteral2564458223;
- extern String_t* _stringLiteral1454528960;
- extern String_t* _stringLiteral3013075459;
- extern String_t* _stringLiteral2729111217;
- extern String_t* _stringLiteral3822669038;
- extern String_t* _stringLiteral2921184537;
- extern String_t* _stringLiteral3024622086;
- extern String_t* _stringLiteral630218565;
- extern String_t* _stringLiteral2406798247;
- extern String_t* _stringLiteral4254451314;
- extern String_t* _stringLiteral3699321548;
- extern String_t* _stringLiteral3956817887;
- extern String_t* _stringLiteral3332460623;
- extern String_t* _stringLiteral742876383;
- extern String_t* _stringLiteral3455760331;
- extern String_t* _stringLiteral922536097;
- extern String_t* _stringLiteral1757920701;
- extern String_t* _stringLiteral1486761124;
- extern String_t* _stringLiteral1570321587;
- extern String_t* _stringLiteral3215840460;
- extern String_t* _stringLiteral3135612287;
- extern String_t* _stringLiteral2446588013;
- extern String_t* _stringLiteral2328036797;
- extern String_t* _stringLiteral850590460;
- extern String_t* _stringLiteral2459688246;
- extern String_t* _stringLiteral1701458771;
- extern String_t* _stringLiteral2534080674;
- extern String_t* _stringLiteral3341417625;
- extern const uint32_t UnityEngineTransformWrap___Register_m4209511146_MetadataUsageId;
- extern String_t* _stringLiteral2137581584;
- extern const uint32_t UnityEngineTransformWrap___CreateInstance_m1894308163_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var;
- extern String_t* _stringLiteral2357750343;
- extern const uint32_t UnityEngineTransformWrap__m_SetParent_m804936730_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Get_TisSpace_t654135784_m3053450216_RuntimeMethod_var;
- extern String_t* _stringLiteral2847057996;
- extern const uint32_t UnityEngineTransformWrap__m_Translate_m975680681_MetadataUsageId;
- extern String_t* _stringLiteral2170683248;
- extern const uint32_t UnityEngineTransformWrap__m_Rotate_m1066480346_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_RotateAround_m3000108533_MetadataUsageId;
- extern String_t* _stringLiteral1462846399;
- extern const uint32_t UnityEngineTransformWrap__m_LookAt_m1878060840_MetadataUsageId;
- extern String_t* _stringLiteral2255970592;
- extern const uint32_t UnityEngineTransformWrap__m_TransformDirection_m4138306096_MetadataUsageId;
- extern String_t* _stringLiteral3338612227;
- extern const uint32_t UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164_MetadataUsageId;
- extern String_t* _stringLiteral154830841;
- extern const uint32_t UnityEngineTransformWrap__m_TransformVector_m1514244944_MetadataUsageId;
- extern String_t* _stringLiteral1851749169;
- extern const uint32_t UnityEngineTransformWrap__m_InverseTransformVector_m1349495655_MetadataUsageId;
- extern String_t* _stringLiteral3485366427;
- extern const uint32_t UnityEngineTransformWrap__m_TransformPoint_m1078881144_MetadataUsageId;
- extern String_t* _stringLiteral1960680026;
- extern const uint32_t UnityEngineTransformWrap__m_InverseTransformPoint_m957968118_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DetachChildren_m520041245_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_Find_m1578719640_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_IsChildOf_m764668816_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_GetEnumerator_m2850786488_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_GetChild_m1976232125_MetadataUsageId;
- extern String_t* _stringLiteral1824945474;
- extern const uint32_t UnityEngineTransformWrap__m_DOMove_m2510464153_MetadataUsageId;
- extern String_t* _stringLiteral4216650904;
- extern const uint32_t UnityEngineTransformWrap__m_DOMoveX_m427706497_MetadataUsageId;
- extern String_t* _stringLiteral4216716440;
- extern const uint32_t UnityEngineTransformWrap__m_DOMoveY_m3829814726_MetadataUsageId;
- extern String_t* _stringLiteral4216519832;
- extern const uint32_t UnityEngineTransformWrap__m_DOMoveZ_m3431864067_MetadataUsageId;
- extern String_t* _stringLiteral3603685919;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalMove_m602687662_MetadataUsageId;
- extern String_t* _stringLiteral342541532;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224_MetadataUsageId;
- extern String_t* _stringLiteral3071424887;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027_MetadataUsageId;
- extern String_t* _stringLiteral3474709414;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_RuntimeMethod_var;
- extern String_t* _stringLiteral3084911464;
- extern const uint32_t UnityEngineTransformWrap__m_DORotate_m825617719_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720_MetadataUsageId;
- extern String_t* _stringLiteral3178538062;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalRotate_m4095437176_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094_MetadataUsageId;
- extern String_t* _stringLiteral1033067621;
- extern const uint32_t UnityEngineTransformWrap__m_DOScale_m1896281278_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DOScaleX_m2063790813_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DOScaleY_m3874994172_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DOScaleZ_m976566461_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisNullable_1_t1149908250_m1171964725_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Get_TisNullable_1_t1149908250_m3400041693_RuntimeMethod_var;
- extern String_t* _stringLiteral4263630979;
- extern const uint32_t UnityEngineTransformWrap__m_DOLookAt_m89020156_MetadataUsageId;
- extern String_t* _stringLiteral2339517550;
- extern const uint32_t UnityEngineTransformWrap__m_DOPunchPosition_m1266900073_MetadataUsageId;
- extern String_t* _stringLiteral912903002;
- extern const uint32_t UnityEngineTransformWrap__m_DOPunchScale_m2535020043_MetadataUsageId;
- extern String_t* _stringLiteral3969395025;
- extern const uint32_t UnityEngineTransformWrap__m_DOPunchRotation_m3158922004_MetadataUsageId;
- extern String_t* _stringLiteral2939556566;
- extern const uint32_t UnityEngineTransformWrap__m_DOShakePosition_m3720856662_MetadataUsageId;
- extern String_t* _stringLiteral3401268765;
- extern const uint32_t UnityEngineTransformWrap__m_DOShakeRotation_m241003690_MetadataUsageId;
- extern String_t* _stringLiteral3523906611;
- extern const uint32_t UnityEngineTransformWrap__m_DOShakeScale_m2406116869_MetadataUsageId;
- extern String_t* _stringLiteral3400301185;
- extern const uint32_t UnityEngineTransformWrap__m_DOJump_m4133327798_MetadataUsageId;
- extern String_t* _stringLiteral2365651477;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalJump_m296616187_MetadataUsageId;
- extern const RuntimeType* Path_t3614338981_0_0_0_var;
- extern const RuntimeType* Vector3U5BU5D_t1718750761_0_0_0_var;
- extern RuntimeClass* Path_t3614338981_il2cpp_TypeInfo_var;
- extern RuntimeClass* Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576_RuntimeMethod_var;
- extern const RuntimeMethod* ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195_RuntimeMethod_var;
- extern String_t* _stringLiteral2954888021;
- extern const uint32_t UnityEngineTransformWrap__m_DOPath_m2509685622_MetadataUsageId;
- extern String_t* _stringLiteral2763411632;
- extern const uint32_t UnityEngineTransformWrap__m_DOLocalPath_m442715724_MetadataUsageId;
- extern String_t* _stringLiteral2799908669;
- extern const uint32_t UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954_MetadataUsageId;
- extern String_t* _stringLiteral392136173;
- extern const uint32_t UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229_MetadataUsageId;
- extern String_t* _stringLiteral2408300189;
- extern const uint32_t UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984_MetadataUsageId;
- extern String_t* _stringLiteral1875094018;
- extern const uint32_t UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246_MetadataUsageId;
- extern String_t* _stringLiteral1467047356;
- extern const uint32_t UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_position_m2180048924_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_localPosition_m3878105019_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_eulerAngles_m3922999519_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_right_m469775628_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_up_m3208095539_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_forward_m2765842083_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_rotation_m1745653753_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_localRotation_m637984894_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_localScale_m3915212871_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_parent_m3003513812_MetadataUsageId;
- extern RuntimeClass* Matrix4x4_t1817901843_il2cpp_TypeInfo_var;
- extern const uint32_t UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_root_m58896500_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_childCount_m222537369_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_lossyScale_m3129807950_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_hasChanged_m2133940418_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_position_m2248180735_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_localPosition_m572438127_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_eulerAngles_m2405101980_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_right_m1502050898_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_up_m1616193993_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_forward_m1425629139_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_rotation_m2344385924_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_localRotation_m3029152408_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_localScale_m1212933853_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_parent_m3451686420_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_hasChanged_m195551608_MetadataUsageId;
- extern const uint32_t UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174_MetadataUsageId;
- extern const RuntimeType* Vector2_t2156229523_0_0_0_var;
- extern RuntimeClass* UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var;
- extern RuntimeClass* Single_t1397266774_il2cpp_TypeInfo_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___AddMeta_m377273840_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___SubMeta_m2441875035_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___UnmMeta_m4167622536_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___MulMeta_m3110680190_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___DivMeta_m697562865_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___EqMeta_m3842372935_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Set_m4206157458_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Scale_m3402797960_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Normalize_m2064805032_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_ToString_m3633924156_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_GetHashCode_m3805233334_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Equals_m4260714512_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_normalized_m1526536551_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_magnitude_m1920742942_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_x_m4147433016_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_y_m2714693255_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__s_set_x_m2341483890_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__s_set_y_m3798992961_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___CSIndexer_m1160094481_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___NewIndexer_m2412137810_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap___CreateInstance_m3609981491_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_zero_m4234870038_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_one_m1876688525_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_up_m2923378165_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_down_m2946352740_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_left_m158211399_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_right_m77832184_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909_RuntimeMethod_var;
- extern const RuntimeMethod* UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575_RuntimeMethod_var;
- extern String_t* _stringLiteral3641224616;
- extern String_t* _stringLiteral516640048;
- extern String_t* _stringLiteral2106406493;
- extern String_t* _stringLiteral2035669812;
- extern String_t* _stringLiteral3193310087;
- extern String_t* _stringLiteral4245602690;
- extern String_t* _stringLiteral2553217843;
- extern String_t* _stringLiteral763145517;
- extern String_t* _stringLiteral347475160;
- extern String_t* _stringLiteral476607165;
- extern String_t* _stringLiteral3610063950;
- extern String_t* _stringLiteral377894624;
- extern String_t* _stringLiteral349801912;
- extern String_t* _stringLiteral1482132450;
- extern String_t* _stringLiteral377862080;
- extern String_t* _stringLiteral3452614616;
- extern String_t* _stringLiteral3452614615;
- extern String_t* _stringLiteral1976572404;
- extern String_t* _stringLiteral1522248929;
- extern String_t* _stringLiteral2715533145;
- extern String_t* _stringLiteral1279211325;
- extern String_t* _stringLiteral2553611042;
- extern String_t* _stringLiteral4262356921;
- extern String_t* _stringLiteral96702336;
- extern String_t* _stringLiteral3883988357;
- extern String_t* _stringLiteral653878301;
- extern String_t* _stringLiteral4073034039;
- extern String_t* _stringLiteral4166618085;
- extern String_t* _stringLiteral1734049320;
- extern String_t* _stringLiteral3580117429;
- extern String_t* _stringLiteral1256528358;
- extern String_t* _stringLiteral1700053330;
- extern String_t* _stringLiteral60121299;
- extern String_t* _stringLiteral4249957872;
- extern String_t* _stringLiteral1269054116;
- extern String_t* _stringLiteral1769437942;
- extern const uint32_t UnityEngineVector2Wrap___Register_m818258078_MetadataUsageId;
- extern String_t* _stringLiteral3699549820;
- extern const uint32_t UnityEngineVector2Wrap___CreateInstance_m3609981491_MetadataUsageId;
- extern const RuntimeMethod* ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var;
- extern const uint32_t UnityEngineVector2Wrap___CSIndexer_m1160094481_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap___NewIndexer_m2412137810_MetadataUsageId;
- extern RuntimeClass* Vector2_t2156229523_il2cpp_TypeInfo_var;
- extern String_t* _stringLiteral4081218855;
- extern const uint32_t UnityEngineVector2Wrap___AddMeta_m377273840_MetadataUsageId;
- extern String_t* _stringLiteral3789986232;
- extern const uint32_t UnityEngineVector2Wrap___SubMeta_m2441875035_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap___UnmMeta_m4167622536_MetadataUsageId;
- extern String_t* _stringLiteral442136271;
- extern const uint32_t UnityEngineVector2Wrap___MulMeta_m3110680190_MetadataUsageId;
- extern String_t* _stringLiteral1864468633;
- extern const uint32_t UnityEngineVector2Wrap___DivMeta_m697562865_MetadataUsageId;
- extern String_t* _stringLiteral1882008321;
- extern const uint32_t UnityEngineVector2Wrap___EqMeta_m3842372935_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Set_m4206157458_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Scale_m3402797960_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Normalize_m2064805032_MetadataUsageId;
- extern String_t* _stringLiteral3137284987;
- extern const uint32_t UnityEngineVector2Wrap__m_ToString_m3633924156_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_GetHashCode_m3805233334_MetadataUsageId;
- extern const RuntimeType* RuntimeObject_0_0_0_var;
- extern const uint32_t UnityEngineVector2Wrap__m_Equals_m4260714512_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_normalized_m1526536551_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_magnitude_m1920742942_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_zero_m4234870038_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_one_m1876688525_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_up_m2923378165_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_down_m2946352740_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_left_m158211399_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_right_m77832184_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_x_m4147433016_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__g_get_y_m2714693255_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__s_set_x_m2341483890_MetadataUsageId;
- extern const uint32_t UnityEngineVector2Wrap__s_set_y_m3798992961_MetadataUsageId;
- struct ObjectU5BU5D_t1417781964;
- struct TransformU5BU5D_t807237628;
- struct ByteU5BU5D_t4116647657;
- struct Vector3U5BU5D_t1718750761;
- #ifndef RUNTIMEOBJECT_H
- #define RUNTIMEOBJECT_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Object
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // RUNTIMEOBJECT_H
- struct Il2CppArrayBounds;
- #ifndef RUNTIMEARRAY_H
- #define RUNTIMEARRAY_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Array
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // RUNTIMEARRAY_H
- #ifndef EXCEPTION_T_H
- #define EXCEPTION_T_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Exception
- struct Exception_t : public RuntimeObject
- {
- public:
- // System.IntPtr[] System.Exception::trace_ips
- IntPtrU5BU5D_t4013366056* ___trace_ips_0;
- // System.Exception System.Exception::inner_exception
- Exception_t * ___inner_exception_1;
- // System.String System.Exception::message
- String_t* ___message_2;
- // System.String System.Exception::help_link
- String_t* ___help_link_3;
- // System.String System.Exception::class_name
- String_t* ___class_name_4;
- // System.String System.Exception::stack_trace
- String_t* ___stack_trace_5;
- // System.String System.Exception::_remoteStackTraceString
- String_t* ____remoteStackTraceString_6;
- // System.Int32 System.Exception::remote_stack_index
- int32_t ___remote_stack_index_7;
- // System.Int32 System.Exception::hresult
- int32_t ___hresult_8;
- // System.String System.Exception::source
- String_t* ___source_9;
- // System.Collections.IDictionary System.Exception::_data
- RuntimeObject* ____data_10;
- public:
- inline static int32_t get_offset_of_trace_ips_0() { return static_cast<int32_t>(offsetof(Exception_t, ___trace_ips_0)); }
- inline IntPtrU5BU5D_t4013366056* get_trace_ips_0() const { return ___trace_ips_0; }
- inline IntPtrU5BU5D_t4013366056** get_address_of_trace_ips_0() { return &___trace_ips_0; }
- inline void set_trace_ips_0(IntPtrU5BU5D_t4013366056* value)
- {
- ___trace_ips_0 = value;
- Il2CppCodeGenWriteBarrier((&___trace_ips_0), value);
- }
- inline static int32_t get_offset_of_inner_exception_1() { return static_cast<int32_t>(offsetof(Exception_t, ___inner_exception_1)); }
- inline Exception_t * get_inner_exception_1() const { return ___inner_exception_1; }
- inline Exception_t ** get_address_of_inner_exception_1() { return &___inner_exception_1; }
- inline void set_inner_exception_1(Exception_t * value)
- {
- ___inner_exception_1 = value;
- Il2CppCodeGenWriteBarrier((&___inner_exception_1), value);
- }
- inline static int32_t get_offset_of_message_2() { return static_cast<int32_t>(offsetof(Exception_t, ___message_2)); }
- inline String_t* get_message_2() const { return ___message_2; }
- inline String_t** get_address_of_message_2() { return &___message_2; }
- inline void set_message_2(String_t* value)
- {
- ___message_2 = value;
- Il2CppCodeGenWriteBarrier((&___message_2), value);
- }
- inline static int32_t get_offset_of_help_link_3() { return static_cast<int32_t>(offsetof(Exception_t, ___help_link_3)); }
- inline String_t* get_help_link_3() const { return ___help_link_3; }
- inline String_t** get_address_of_help_link_3() { return &___help_link_3; }
- inline void set_help_link_3(String_t* value)
- {
- ___help_link_3 = value;
- Il2CppCodeGenWriteBarrier((&___help_link_3), value);
- }
- inline static int32_t get_offset_of_class_name_4() { return static_cast<int32_t>(offsetof(Exception_t, ___class_name_4)); }
- inline String_t* get_class_name_4() const { return ___class_name_4; }
- inline String_t** get_address_of_class_name_4() { return &___class_name_4; }
- inline void set_class_name_4(String_t* value)
- {
- ___class_name_4 = value;
- Il2CppCodeGenWriteBarrier((&___class_name_4), value);
- }
- inline static int32_t get_offset_of_stack_trace_5() { return static_cast<int32_t>(offsetof(Exception_t, ___stack_trace_5)); }
- inline String_t* get_stack_trace_5() const { return ___stack_trace_5; }
- inline String_t** get_address_of_stack_trace_5() { return &___stack_trace_5; }
- inline void set_stack_trace_5(String_t* value)
- {
- ___stack_trace_5 = value;
- Il2CppCodeGenWriteBarrier((&___stack_trace_5), value);
- }
- inline static int32_t get_offset_of__remoteStackTraceString_6() { return static_cast<int32_t>(offsetof(Exception_t, ____remoteStackTraceString_6)); }
- inline String_t* get__remoteStackTraceString_6() const { return ____remoteStackTraceString_6; }
- inline String_t** get_address_of__remoteStackTraceString_6() { return &____remoteStackTraceString_6; }
- inline void set__remoteStackTraceString_6(String_t* value)
- {
- ____remoteStackTraceString_6 = value;
- Il2CppCodeGenWriteBarrier((&____remoteStackTraceString_6), value);
- }
- inline static int32_t get_offset_of_remote_stack_index_7() { return static_cast<int32_t>(offsetof(Exception_t, ___remote_stack_index_7)); }
- inline int32_t get_remote_stack_index_7() const { return ___remote_stack_index_7; }
- inline int32_t* get_address_of_remote_stack_index_7() { return &___remote_stack_index_7; }
- inline void set_remote_stack_index_7(int32_t value)
- {
- ___remote_stack_index_7 = value;
- }
- inline static int32_t get_offset_of_hresult_8() { return static_cast<int32_t>(offsetof(Exception_t, ___hresult_8)); }
- inline int32_t get_hresult_8() const { return ___hresult_8; }
- inline int32_t* get_address_of_hresult_8() { return &___hresult_8; }
- inline void set_hresult_8(int32_t value)
- {
- ___hresult_8 = value;
- }
- inline static int32_t get_offset_of_source_9() { return static_cast<int32_t>(offsetof(Exception_t, ___source_9)); }
- inline String_t* get_source_9() const { return ___source_9; }
- inline String_t** get_address_of_source_9() { return &___source_9; }
- inline void set_source_9(String_t* value)
- {
- ___source_9 = value;
- Il2CppCodeGenWriteBarrier((&___source_9), value);
- }
- inline static int32_t get_offset_of__data_10() { return static_cast<int32_t>(offsetof(Exception_t, ____data_10)); }
- inline RuntimeObject* get__data_10() const { return ____data_10; }
- inline RuntimeObject** get_address_of__data_10() { return &____data_10; }
- inline void set__data_10(RuntimeObject* value)
- {
- ____data_10 = value;
- Il2CppCodeGenWriteBarrier((&____data_10), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // EXCEPTION_T_H
- #ifndef UNITYENGINESKINNEDMESHRENDERERWRAP_T4180069450_H
- #define UNITYENGINESKINNEDMESHRENDERERWRAP_T4180069450_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap
- struct UnityEngineSkinnedMeshRendererWrap_t4180069450 : public RuntimeObject
- {
- public:
- public:
- };
- struct UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields
- {
- public:
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_0;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_1;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_2;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_3;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache4
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4_4;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache5
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache5_5;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache6
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache6_6;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache7
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache7_7;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache8
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache8_8;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache9
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache9_9;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cacheA
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheA_10;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cacheB
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheB_11;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cacheC
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheC_12;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cacheD
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheD_13;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cacheE
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheE_14;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cacheF
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheF_15;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache10
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache10_16;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::<>f__mg$cache11
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache11_17;
- public:
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_0() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache0_0)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_0() const { return ___U3CU3Ef__mgU24cache0_0; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_0() { return &___U3CU3Ef__mgU24cache0_0; }
- inline void set_U3CU3Ef__mgU24cache0_0(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_0 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_0), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_1() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache1_1)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_1() const { return ___U3CU3Ef__mgU24cache1_1; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_1() { return &___U3CU3Ef__mgU24cache1_1; }
- inline void set_U3CU3Ef__mgU24cache1_1(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_1 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_1), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_2() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache2_2)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_2() const { return ___U3CU3Ef__mgU24cache2_2; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_2() { return &___U3CU3Ef__mgU24cache2_2; }
- inline void set_U3CU3Ef__mgU24cache2_2(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_2 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_2), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_3() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache3_3)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_3() const { return ___U3CU3Ef__mgU24cache3_3; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_3() { return &___U3CU3Ef__mgU24cache3_3; }
- inline void set_U3CU3Ef__mgU24cache3_3(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_3 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_3), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4_4() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache4_4)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4_4() const { return ___U3CU3Ef__mgU24cache4_4; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4_4() { return &___U3CU3Ef__mgU24cache4_4; }
- inline void set_U3CU3Ef__mgU24cache4_4(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4_4 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4_4), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache5_5() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache5_5)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache5_5() const { return ___U3CU3Ef__mgU24cache5_5; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache5_5() { return &___U3CU3Ef__mgU24cache5_5; }
- inline void set_U3CU3Ef__mgU24cache5_5(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache5_5 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache5_5), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache6_6() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache6_6)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache6_6() const { return ___U3CU3Ef__mgU24cache6_6; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache6_6() { return &___U3CU3Ef__mgU24cache6_6; }
- inline void set_U3CU3Ef__mgU24cache6_6(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache6_6 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache6_6), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache7_7() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache7_7)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache7_7() const { return ___U3CU3Ef__mgU24cache7_7; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache7_7() { return &___U3CU3Ef__mgU24cache7_7; }
- inline void set_U3CU3Ef__mgU24cache7_7(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache7_7 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache7_7), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache8_8() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache8_8)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache8_8() const { return ___U3CU3Ef__mgU24cache8_8; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache8_8() { return &___U3CU3Ef__mgU24cache8_8; }
- inline void set_U3CU3Ef__mgU24cache8_8(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache8_8 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache8_8), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache9_9() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache9_9)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache9_9() const { return ___U3CU3Ef__mgU24cache9_9; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache9_9() { return &___U3CU3Ef__mgU24cache9_9; }
- inline void set_U3CU3Ef__mgU24cache9_9(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache9_9 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache9_9), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheA_10() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cacheA_10)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheA_10() const { return ___U3CU3Ef__mgU24cacheA_10; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheA_10() { return &___U3CU3Ef__mgU24cacheA_10; }
- inline void set_U3CU3Ef__mgU24cacheA_10(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheA_10 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheA_10), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheB_11() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cacheB_11)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheB_11() const { return ___U3CU3Ef__mgU24cacheB_11; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheB_11() { return &___U3CU3Ef__mgU24cacheB_11; }
- inline void set_U3CU3Ef__mgU24cacheB_11(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheB_11 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheB_11), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheC_12() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cacheC_12)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheC_12() const { return ___U3CU3Ef__mgU24cacheC_12; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheC_12() { return &___U3CU3Ef__mgU24cacheC_12; }
- inline void set_U3CU3Ef__mgU24cacheC_12(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheC_12 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheC_12), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheD_13() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cacheD_13)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheD_13() const { return ___U3CU3Ef__mgU24cacheD_13; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheD_13() { return &___U3CU3Ef__mgU24cacheD_13; }
- inline void set_U3CU3Ef__mgU24cacheD_13(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheD_13 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheD_13), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheE_14() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cacheE_14)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheE_14() const { return ___U3CU3Ef__mgU24cacheE_14; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheE_14() { return &___U3CU3Ef__mgU24cacheE_14; }
- inline void set_U3CU3Ef__mgU24cacheE_14(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheE_14 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheE_14), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheF_15() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cacheF_15)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheF_15() const { return ___U3CU3Ef__mgU24cacheF_15; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheF_15() { return &___U3CU3Ef__mgU24cacheF_15; }
- inline void set_U3CU3Ef__mgU24cacheF_15(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheF_15 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheF_15), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache10_16() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache10_16)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache10_16() const { return ___U3CU3Ef__mgU24cache10_16; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache10_16() { return &___U3CU3Ef__mgU24cache10_16; }
- inline void set_U3CU3Ef__mgU24cache10_16(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache10_16 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache10_16), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache11_17() { return static_cast<int32_t>(offsetof(UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields, ___U3CU3Ef__mgU24cache11_17)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache11_17() const { return ___U3CU3Ef__mgU24cache11_17; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache11_17() { return &___U3CU3Ef__mgU24cache11_17; }
- inline void set_U3CU3Ef__mgU24cache11_17(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache11_17 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache11_17), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UNITYENGINESKINNEDMESHRENDERERWRAP_T4180069450_H
- #ifndef YIELDINSTRUCTION_T403091072_H
- #define YIELDINSTRUCTION_T403091072_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.YieldInstruction
- struct YieldInstruction_t403091072 : public RuntimeObject
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of UnityEngine.YieldInstruction
- struct YieldInstruction_t403091072_marshaled_pinvoke
- {
- };
- // Native definition for COM marshalling of UnityEngine.YieldInstruction
- struct YieldInstruction_t403091072_marshaled_com
- {
- };
- #endif // YIELDINSTRUCTION_T403091072_H
- #ifndef MEMBERINFO_T_H
- #define MEMBERINFO_T_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Reflection.MemberInfo
- struct MemberInfo_t : public RuntimeObject
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // MEMBERINFO_T_H
- #ifndef VALUETYPE_T3640485471_H
- #define VALUETYPE_T3640485471_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.ValueType
- struct ValueType_t3640485471 : public RuntimeObject
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of System.ValueType
- struct ValueType_t3640485471_marshaled_pinvoke
- {
- };
- // Native definition for COM marshalling of System.ValueType
- struct ValueType_t3640485471_marshaled_com
- {
- };
- #endif // VALUETYPE_T3640485471_H
- #ifndef UNITYENGINETEXTASSETWRAP_T3364475192_H
- #define UNITYENGINETEXTASSETWRAP_T3364475192_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.CSObjectWrap.UnityEngineTextAssetWrap
- struct UnityEngineTextAssetWrap_t3364475192 : public RuntimeObject
- {
- public:
- public:
- };
- struct UnityEngineTextAssetWrap_t3364475192_StaticFields
- {
- public:
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTextAssetWrap::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_0;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTextAssetWrap::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_1;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTextAssetWrap::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_2;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTextAssetWrap::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_3;
- public:
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_0() { return static_cast<int32_t>(offsetof(UnityEngineTextAssetWrap_t3364475192_StaticFields, ___U3CU3Ef__mgU24cache0_0)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_0() const { return ___U3CU3Ef__mgU24cache0_0; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_0() { return &___U3CU3Ef__mgU24cache0_0; }
- inline void set_U3CU3Ef__mgU24cache0_0(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_0 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_0), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_1() { return static_cast<int32_t>(offsetof(UnityEngineTextAssetWrap_t3364475192_StaticFields, ___U3CU3Ef__mgU24cache1_1)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_1() const { return ___U3CU3Ef__mgU24cache1_1; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_1() { return &___U3CU3Ef__mgU24cache1_1; }
- inline void set_U3CU3Ef__mgU24cache1_1(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_1 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_1), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_2() { return static_cast<int32_t>(offsetof(UnityEngineTextAssetWrap_t3364475192_StaticFields, ___U3CU3Ef__mgU24cache2_2)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_2() const { return ___U3CU3Ef__mgU24cache2_2; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_2() { return &___U3CU3Ef__mgU24cache2_2; }
- inline void set_U3CU3Ef__mgU24cache2_2(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_2 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_2), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_3() { return static_cast<int32_t>(offsetof(UnityEngineTextAssetWrap_t3364475192_StaticFields, ___U3CU3Ef__mgU24cache3_3)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_3() const { return ___U3CU3Ef__mgU24cache3_3; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_3() { return &___U3CU3Ef__mgU24cache3_3; }
- inline void set_U3CU3Ef__mgU24cache3_3(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_3 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_3), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UNITYENGINETEXTASSETWRAP_T3364475192_H
- #ifndef UNITYENGINETIMEWRAP_T504182158_H
- #define UNITYENGINETIMEWRAP_T504182158_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.CSObjectWrap.UnityEngineTimeWrap
- struct UnityEngineTimeWrap_t504182158 : public RuntimeObject
- {
- public:
- public:
- };
- struct UnityEngineTimeWrap_t504182158_StaticFields
- {
- public:
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_0;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_1;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_2;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_3;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache4
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4_4;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache5
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache5_5;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache6
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache6_6;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache7
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache7_7;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache8
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache8_8;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache9
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache9_9;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cacheA
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheA_10;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cacheB
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheB_11;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cacheC
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheC_12;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cacheD
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheD_13;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cacheE
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheE_14;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cacheF
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheF_15;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache10
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache10_16;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache11
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache11_17;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache12
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache12_18;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache13
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache13_19;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache14
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache14_20;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache15
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache15_21;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache16
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache16_22;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTimeWrap::<>f__mg$cache17
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache17_23;
- public:
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_0() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache0_0)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_0() const { return ___U3CU3Ef__mgU24cache0_0; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_0() { return &___U3CU3Ef__mgU24cache0_0; }
- inline void set_U3CU3Ef__mgU24cache0_0(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_0 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_0), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_1() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache1_1)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_1() const { return ___U3CU3Ef__mgU24cache1_1; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_1() { return &___U3CU3Ef__mgU24cache1_1; }
- inline void set_U3CU3Ef__mgU24cache1_1(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_1 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_1), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_2() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache2_2)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_2() const { return ___U3CU3Ef__mgU24cache2_2; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_2() { return &___U3CU3Ef__mgU24cache2_2; }
- inline void set_U3CU3Ef__mgU24cache2_2(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_2 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_2), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_3() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache3_3)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_3() const { return ___U3CU3Ef__mgU24cache3_3; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_3() { return &___U3CU3Ef__mgU24cache3_3; }
- inline void set_U3CU3Ef__mgU24cache3_3(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_3 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_3), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4_4() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache4_4)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4_4() const { return ___U3CU3Ef__mgU24cache4_4; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4_4() { return &___U3CU3Ef__mgU24cache4_4; }
- inline void set_U3CU3Ef__mgU24cache4_4(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4_4 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4_4), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache5_5() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache5_5)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache5_5() const { return ___U3CU3Ef__mgU24cache5_5; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache5_5() { return &___U3CU3Ef__mgU24cache5_5; }
- inline void set_U3CU3Ef__mgU24cache5_5(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache5_5 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache5_5), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache6_6() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache6_6)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache6_6() const { return ___U3CU3Ef__mgU24cache6_6; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache6_6() { return &___U3CU3Ef__mgU24cache6_6; }
- inline void set_U3CU3Ef__mgU24cache6_6(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache6_6 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache6_6), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache7_7() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache7_7)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache7_7() const { return ___U3CU3Ef__mgU24cache7_7; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache7_7() { return &___U3CU3Ef__mgU24cache7_7; }
- inline void set_U3CU3Ef__mgU24cache7_7(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache7_7 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache7_7), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache8_8() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache8_8)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache8_8() const { return ___U3CU3Ef__mgU24cache8_8; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache8_8() { return &___U3CU3Ef__mgU24cache8_8; }
- inline void set_U3CU3Ef__mgU24cache8_8(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache8_8 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache8_8), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache9_9() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache9_9)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache9_9() const { return ___U3CU3Ef__mgU24cache9_9; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache9_9() { return &___U3CU3Ef__mgU24cache9_9; }
- inline void set_U3CU3Ef__mgU24cache9_9(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache9_9 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache9_9), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheA_10() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cacheA_10)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheA_10() const { return ___U3CU3Ef__mgU24cacheA_10; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheA_10() { return &___U3CU3Ef__mgU24cacheA_10; }
- inline void set_U3CU3Ef__mgU24cacheA_10(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheA_10 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheA_10), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheB_11() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cacheB_11)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheB_11() const { return ___U3CU3Ef__mgU24cacheB_11; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheB_11() { return &___U3CU3Ef__mgU24cacheB_11; }
- inline void set_U3CU3Ef__mgU24cacheB_11(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheB_11 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheB_11), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheC_12() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cacheC_12)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheC_12() const { return ___U3CU3Ef__mgU24cacheC_12; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheC_12() { return &___U3CU3Ef__mgU24cacheC_12; }
- inline void set_U3CU3Ef__mgU24cacheC_12(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheC_12 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheC_12), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheD_13() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cacheD_13)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheD_13() const { return ___U3CU3Ef__mgU24cacheD_13; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheD_13() { return &___U3CU3Ef__mgU24cacheD_13; }
- inline void set_U3CU3Ef__mgU24cacheD_13(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheD_13 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheD_13), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheE_14() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cacheE_14)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheE_14() const { return ___U3CU3Ef__mgU24cacheE_14; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheE_14() { return &___U3CU3Ef__mgU24cacheE_14; }
- inline void set_U3CU3Ef__mgU24cacheE_14(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheE_14 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheE_14), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheF_15() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cacheF_15)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheF_15() const { return ___U3CU3Ef__mgU24cacheF_15; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheF_15() { return &___U3CU3Ef__mgU24cacheF_15; }
- inline void set_U3CU3Ef__mgU24cacheF_15(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheF_15 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheF_15), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache10_16() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache10_16)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache10_16() const { return ___U3CU3Ef__mgU24cache10_16; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache10_16() { return &___U3CU3Ef__mgU24cache10_16; }
- inline void set_U3CU3Ef__mgU24cache10_16(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache10_16 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache10_16), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache11_17() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache11_17)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache11_17() const { return ___U3CU3Ef__mgU24cache11_17; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache11_17() { return &___U3CU3Ef__mgU24cache11_17; }
- inline void set_U3CU3Ef__mgU24cache11_17(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache11_17 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache11_17), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache12_18() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache12_18)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache12_18() const { return ___U3CU3Ef__mgU24cache12_18; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache12_18() { return &___U3CU3Ef__mgU24cache12_18; }
- inline void set_U3CU3Ef__mgU24cache12_18(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache12_18 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache12_18), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache13_19() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache13_19)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache13_19() const { return ___U3CU3Ef__mgU24cache13_19; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache13_19() { return &___U3CU3Ef__mgU24cache13_19; }
- inline void set_U3CU3Ef__mgU24cache13_19(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache13_19 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache13_19), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache14_20() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache14_20)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache14_20() const { return ___U3CU3Ef__mgU24cache14_20; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache14_20() { return &___U3CU3Ef__mgU24cache14_20; }
- inline void set_U3CU3Ef__mgU24cache14_20(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache14_20 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache14_20), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache15_21() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache15_21)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache15_21() const { return ___U3CU3Ef__mgU24cache15_21; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache15_21() { return &___U3CU3Ef__mgU24cache15_21; }
- inline void set_U3CU3Ef__mgU24cache15_21(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache15_21 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache15_21), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache16_22() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache16_22)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache16_22() const { return ___U3CU3Ef__mgU24cache16_22; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache16_22() { return &___U3CU3Ef__mgU24cache16_22; }
- inline void set_U3CU3Ef__mgU24cache16_22(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache16_22 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache16_22), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache17_23() { return static_cast<int32_t>(offsetof(UnityEngineTimeWrap_t504182158_StaticFields, ___U3CU3Ef__mgU24cache17_23)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache17_23() const { return ___U3CU3Ef__mgU24cache17_23; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache17_23() { return &___U3CU3Ef__mgU24cache17_23; }
- inline void set_U3CU3Ef__mgU24cache17_23(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache17_23 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache17_23), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UNITYENGINETIMEWRAP_T504182158_H
- #ifndef TIME_T2420636075_H
- #define TIME_T2420636075_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Time
- struct Time_t2420636075 : public RuntimeObject
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TIME_T2420636075_H
- #ifndef UNITYENGINETRANSFORMWRAP_T3488644103_H
- #define UNITYENGINETRANSFORMWRAP_T3488644103_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.CSObjectWrap.UnityEngineTransformWrap
- struct UnityEngineTransformWrap_t3488644103 : public RuntimeObject
- {
- public:
- public:
- };
- struct UnityEngineTransformWrap_t3488644103_StaticFields
- {
- public:
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_0;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_1;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_2;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_3;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4_4;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache5
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache5_5;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache6
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache6_6;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache7
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache7_7;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache8
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache8_8;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache9
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache9_9;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cacheA
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheA_10;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cacheB
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheB_11;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cacheC
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheC_12;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cacheD
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheD_13;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cacheE
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheE_14;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cacheF
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheF_15;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache10
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache10_16;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache11
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache11_17;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache12
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache12_18;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache13
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache13_19;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache14
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache14_20;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache15
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache15_21;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache16
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache16_22;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache17
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache17_23;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache18
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache18_24;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache19
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache19_25;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1A
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1A_26;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1B
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1B_27;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1C
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1C_28;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1D
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1D_29;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1E
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1E_30;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache1F
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1F_31;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache20
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache20_32;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache21
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache21_33;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache22
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache22_34;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache23
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache23_35;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache24
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache24_36;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache25
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache25_37;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache26
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache26_38;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache27
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache27_39;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache28
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache28_40;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache29
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache29_41;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2A
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2A_42;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2B
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2B_43;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2C
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2C_44;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2D
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2D_45;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2E
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2E_46;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache2F
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2F_47;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache30
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache30_48;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache31
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache31_49;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache32
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache32_50;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache33
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache33_51;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache34
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache34_52;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache35
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache35_53;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache36
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache36_54;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache37
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache37_55;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache38
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache38_56;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache39
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache39_57;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3A
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3A_58;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3B
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3B_59;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3C
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3C_60;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3D
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3D_61;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3E
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3E_62;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache3F
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3F_63;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache40
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache40_64;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache41
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache41_65;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache42
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache42_66;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache43
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache43_67;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache44
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache44_68;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache45
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache45_69;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache46
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache46_70;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache47
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache47_71;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache48
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache48_72;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache49
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache49_73;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4A
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4A_74;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4B
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4B_75;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4C
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4C_76;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4D
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4D_77;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4E
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4E_78;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache4F
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4F_79;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache50
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache50_80;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache51
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache51_81;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache52
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache52_82;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache53
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache53_83;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache54
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache54_84;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache55
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache55_85;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineTransformWrap::<>f__mg$cache56
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache56_86;
- public:
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_0() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache0_0)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_0() const { return ___U3CU3Ef__mgU24cache0_0; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_0() { return &___U3CU3Ef__mgU24cache0_0; }
- inline void set_U3CU3Ef__mgU24cache0_0(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_0 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_0), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_1() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1_1)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_1() const { return ___U3CU3Ef__mgU24cache1_1; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_1() { return &___U3CU3Ef__mgU24cache1_1; }
- inline void set_U3CU3Ef__mgU24cache1_1(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_1 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_1), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_2() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2_2)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_2() const { return ___U3CU3Ef__mgU24cache2_2; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_2() { return &___U3CU3Ef__mgU24cache2_2; }
- inline void set_U3CU3Ef__mgU24cache2_2(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_2 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_2), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_3() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3_3)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_3() const { return ___U3CU3Ef__mgU24cache3_3; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_3() { return &___U3CU3Ef__mgU24cache3_3; }
- inline void set_U3CU3Ef__mgU24cache3_3(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_3 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_3), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4_4() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4_4)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4_4() const { return ___U3CU3Ef__mgU24cache4_4; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4_4() { return &___U3CU3Ef__mgU24cache4_4; }
- inline void set_U3CU3Ef__mgU24cache4_4(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4_4 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4_4), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache5_5() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache5_5)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache5_5() const { return ___U3CU3Ef__mgU24cache5_5; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache5_5() { return &___U3CU3Ef__mgU24cache5_5; }
- inline void set_U3CU3Ef__mgU24cache5_5(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache5_5 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache5_5), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache6_6() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache6_6)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache6_6() const { return ___U3CU3Ef__mgU24cache6_6; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache6_6() { return &___U3CU3Ef__mgU24cache6_6; }
- inline void set_U3CU3Ef__mgU24cache6_6(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache6_6 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache6_6), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache7_7() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache7_7)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache7_7() const { return ___U3CU3Ef__mgU24cache7_7; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache7_7() { return &___U3CU3Ef__mgU24cache7_7; }
- inline void set_U3CU3Ef__mgU24cache7_7(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache7_7 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache7_7), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache8_8() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache8_8)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache8_8() const { return ___U3CU3Ef__mgU24cache8_8; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache8_8() { return &___U3CU3Ef__mgU24cache8_8; }
- inline void set_U3CU3Ef__mgU24cache8_8(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache8_8 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache8_8), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache9_9() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache9_9)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache9_9() const { return ___U3CU3Ef__mgU24cache9_9; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache9_9() { return &___U3CU3Ef__mgU24cache9_9; }
- inline void set_U3CU3Ef__mgU24cache9_9(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache9_9 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache9_9), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheA_10() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cacheA_10)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheA_10() const { return ___U3CU3Ef__mgU24cacheA_10; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheA_10() { return &___U3CU3Ef__mgU24cacheA_10; }
- inline void set_U3CU3Ef__mgU24cacheA_10(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheA_10 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheA_10), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheB_11() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cacheB_11)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheB_11() const { return ___U3CU3Ef__mgU24cacheB_11; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheB_11() { return &___U3CU3Ef__mgU24cacheB_11; }
- inline void set_U3CU3Ef__mgU24cacheB_11(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheB_11 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheB_11), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheC_12() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cacheC_12)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheC_12() const { return ___U3CU3Ef__mgU24cacheC_12; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheC_12() { return &___U3CU3Ef__mgU24cacheC_12; }
- inline void set_U3CU3Ef__mgU24cacheC_12(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheC_12 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheC_12), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheD_13() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cacheD_13)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheD_13() const { return ___U3CU3Ef__mgU24cacheD_13; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheD_13() { return &___U3CU3Ef__mgU24cacheD_13; }
- inline void set_U3CU3Ef__mgU24cacheD_13(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheD_13 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheD_13), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheE_14() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cacheE_14)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheE_14() const { return ___U3CU3Ef__mgU24cacheE_14; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheE_14() { return &___U3CU3Ef__mgU24cacheE_14; }
- inline void set_U3CU3Ef__mgU24cacheE_14(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheE_14 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheE_14), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheF_15() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cacheF_15)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheF_15() const { return ___U3CU3Ef__mgU24cacheF_15; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheF_15() { return &___U3CU3Ef__mgU24cacheF_15; }
- inline void set_U3CU3Ef__mgU24cacheF_15(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheF_15 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheF_15), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache10_16() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache10_16)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache10_16() const { return ___U3CU3Ef__mgU24cache10_16; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache10_16() { return &___U3CU3Ef__mgU24cache10_16; }
- inline void set_U3CU3Ef__mgU24cache10_16(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache10_16 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache10_16), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache11_17() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache11_17)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache11_17() const { return ___U3CU3Ef__mgU24cache11_17; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache11_17() { return &___U3CU3Ef__mgU24cache11_17; }
- inline void set_U3CU3Ef__mgU24cache11_17(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache11_17 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache11_17), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache12_18() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache12_18)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache12_18() const { return ___U3CU3Ef__mgU24cache12_18; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache12_18() { return &___U3CU3Ef__mgU24cache12_18; }
- inline void set_U3CU3Ef__mgU24cache12_18(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache12_18 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache12_18), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache13_19() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache13_19)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache13_19() const { return ___U3CU3Ef__mgU24cache13_19; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache13_19() { return &___U3CU3Ef__mgU24cache13_19; }
- inline void set_U3CU3Ef__mgU24cache13_19(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache13_19 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache13_19), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache14_20() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache14_20)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache14_20() const { return ___U3CU3Ef__mgU24cache14_20; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache14_20() { return &___U3CU3Ef__mgU24cache14_20; }
- inline void set_U3CU3Ef__mgU24cache14_20(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache14_20 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache14_20), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache15_21() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache15_21)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache15_21() const { return ___U3CU3Ef__mgU24cache15_21; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache15_21() { return &___U3CU3Ef__mgU24cache15_21; }
- inline void set_U3CU3Ef__mgU24cache15_21(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache15_21 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache15_21), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache16_22() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache16_22)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache16_22() const { return ___U3CU3Ef__mgU24cache16_22; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache16_22() { return &___U3CU3Ef__mgU24cache16_22; }
- inline void set_U3CU3Ef__mgU24cache16_22(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache16_22 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache16_22), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache17_23() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache17_23)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache17_23() const { return ___U3CU3Ef__mgU24cache17_23; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache17_23() { return &___U3CU3Ef__mgU24cache17_23; }
- inline void set_U3CU3Ef__mgU24cache17_23(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache17_23 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache17_23), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache18_24() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache18_24)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache18_24() const { return ___U3CU3Ef__mgU24cache18_24; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache18_24() { return &___U3CU3Ef__mgU24cache18_24; }
- inline void set_U3CU3Ef__mgU24cache18_24(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache18_24 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache18_24), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache19_25() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache19_25)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache19_25() const { return ___U3CU3Ef__mgU24cache19_25; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache19_25() { return &___U3CU3Ef__mgU24cache19_25; }
- inline void set_U3CU3Ef__mgU24cache19_25(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache19_25 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache19_25), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1A_26() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1A_26)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1A_26() const { return ___U3CU3Ef__mgU24cache1A_26; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1A_26() { return &___U3CU3Ef__mgU24cache1A_26; }
- inline void set_U3CU3Ef__mgU24cache1A_26(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1A_26 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1A_26), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1B_27() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1B_27)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1B_27() const { return ___U3CU3Ef__mgU24cache1B_27; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1B_27() { return &___U3CU3Ef__mgU24cache1B_27; }
- inline void set_U3CU3Ef__mgU24cache1B_27(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1B_27 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1B_27), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1C_28() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1C_28)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1C_28() const { return ___U3CU3Ef__mgU24cache1C_28; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1C_28() { return &___U3CU3Ef__mgU24cache1C_28; }
- inline void set_U3CU3Ef__mgU24cache1C_28(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1C_28 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1C_28), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1D_29() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1D_29)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1D_29() const { return ___U3CU3Ef__mgU24cache1D_29; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1D_29() { return &___U3CU3Ef__mgU24cache1D_29; }
- inline void set_U3CU3Ef__mgU24cache1D_29(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1D_29 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1D_29), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1E_30() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1E_30)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1E_30() const { return ___U3CU3Ef__mgU24cache1E_30; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1E_30() { return &___U3CU3Ef__mgU24cache1E_30; }
- inline void set_U3CU3Ef__mgU24cache1E_30(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1E_30 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1E_30), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1F_31() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache1F_31)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1F_31() const { return ___U3CU3Ef__mgU24cache1F_31; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1F_31() { return &___U3CU3Ef__mgU24cache1F_31; }
- inline void set_U3CU3Ef__mgU24cache1F_31(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1F_31 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1F_31), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache20_32() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache20_32)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache20_32() const { return ___U3CU3Ef__mgU24cache20_32; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache20_32() { return &___U3CU3Ef__mgU24cache20_32; }
- inline void set_U3CU3Ef__mgU24cache20_32(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache20_32 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache20_32), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache21_33() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache21_33)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache21_33() const { return ___U3CU3Ef__mgU24cache21_33; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache21_33() { return &___U3CU3Ef__mgU24cache21_33; }
- inline void set_U3CU3Ef__mgU24cache21_33(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache21_33 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache21_33), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache22_34() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache22_34)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache22_34() const { return ___U3CU3Ef__mgU24cache22_34; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache22_34() { return &___U3CU3Ef__mgU24cache22_34; }
- inline void set_U3CU3Ef__mgU24cache22_34(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache22_34 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache22_34), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache23_35() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache23_35)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache23_35() const { return ___U3CU3Ef__mgU24cache23_35; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache23_35() { return &___U3CU3Ef__mgU24cache23_35; }
- inline void set_U3CU3Ef__mgU24cache23_35(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache23_35 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache23_35), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache24_36() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache24_36)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache24_36() const { return ___U3CU3Ef__mgU24cache24_36; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache24_36() { return &___U3CU3Ef__mgU24cache24_36; }
- inline void set_U3CU3Ef__mgU24cache24_36(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache24_36 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache24_36), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache25_37() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache25_37)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache25_37() const { return ___U3CU3Ef__mgU24cache25_37; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache25_37() { return &___U3CU3Ef__mgU24cache25_37; }
- inline void set_U3CU3Ef__mgU24cache25_37(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache25_37 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache25_37), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache26_38() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache26_38)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache26_38() const { return ___U3CU3Ef__mgU24cache26_38; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache26_38() { return &___U3CU3Ef__mgU24cache26_38; }
- inline void set_U3CU3Ef__mgU24cache26_38(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache26_38 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache26_38), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache27_39() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache27_39)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache27_39() const { return ___U3CU3Ef__mgU24cache27_39; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache27_39() { return &___U3CU3Ef__mgU24cache27_39; }
- inline void set_U3CU3Ef__mgU24cache27_39(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache27_39 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache27_39), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache28_40() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache28_40)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache28_40() const { return ___U3CU3Ef__mgU24cache28_40; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache28_40() { return &___U3CU3Ef__mgU24cache28_40; }
- inline void set_U3CU3Ef__mgU24cache28_40(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache28_40 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache28_40), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache29_41() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache29_41)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache29_41() const { return ___U3CU3Ef__mgU24cache29_41; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache29_41() { return &___U3CU3Ef__mgU24cache29_41; }
- inline void set_U3CU3Ef__mgU24cache29_41(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache29_41 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache29_41), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2A_42() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2A_42)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2A_42() const { return ___U3CU3Ef__mgU24cache2A_42; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2A_42() { return &___U3CU3Ef__mgU24cache2A_42; }
- inline void set_U3CU3Ef__mgU24cache2A_42(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2A_42 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2A_42), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2B_43() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2B_43)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2B_43() const { return ___U3CU3Ef__mgU24cache2B_43; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2B_43() { return &___U3CU3Ef__mgU24cache2B_43; }
- inline void set_U3CU3Ef__mgU24cache2B_43(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2B_43 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2B_43), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2C_44() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2C_44)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2C_44() const { return ___U3CU3Ef__mgU24cache2C_44; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2C_44() { return &___U3CU3Ef__mgU24cache2C_44; }
- inline void set_U3CU3Ef__mgU24cache2C_44(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2C_44 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2C_44), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2D_45() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2D_45)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2D_45() const { return ___U3CU3Ef__mgU24cache2D_45; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2D_45() { return &___U3CU3Ef__mgU24cache2D_45; }
- inline void set_U3CU3Ef__mgU24cache2D_45(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2D_45 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2D_45), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2E_46() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2E_46)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2E_46() const { return ___U3CU3Ef__mgU24cache2E_46; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2E_46() { return &___U3CU3Ef__mgU24cache2E_46; }
- inline void set_U3CU3Ef__mgU24cache2E_46(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2E_46 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2E_46), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2F_47() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache2F_47)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2F_47() const { return ___U3CU3Ef__mgU24cache2F_47; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2F_47() { return &___U3CU3Ef__mgU24cache2F_47; }
- inline void set_U3CU3Ef__mgU24cache2F_47(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2F_47 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2F_47), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache30_48() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache30_48)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache30_48() const { return ___U3CU3Ef__mgU24cache30_48; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache30_48() { return &___U3CU3Ef__mgU24cache30_48; }
- inline void set_U3CU3Ef__mgU24cache30_48(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache30_48 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache30_48), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache31_49() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache31_49)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache31_49() const { return ___U3CU3Ef__mgU24cache31_49; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache31_49() { return &___U3CU3Ef__mgU24cache31_49; }
- inline void set_U3CU3Ef__mgU24cache31_49(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache31_49 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache31_49), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache32_50() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache32_50)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache32_50() const { return ___U3CU3Ef__mgU24cache32_50; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache32_50() { return &___U3CU3Ef__mgU24cache32_50; }
- inline void set_U3CU3Ef__mgU24cache32_50(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache32_50 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache32_50), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache33_51() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache33_51)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache33_51() const { return ___U3CU3Ef__mgU24cache33_51; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache33_51() { return &___U3CU3Ef__mgU24cache33_51; }
- inline void set_U3CU3Ef__mgU24cache33_51(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache33_51 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache33_51), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache34_52() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache34_52)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache34_52() const { return ___U3CU3Ef__mgU24cache34_52; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache34_52() { return &___U3CU3Ef__mgU24cache34_52; }
- inline void set_U3CU3Ef__mgU24cache34_52(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache34_52 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache34_52), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache35_53() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache35_53)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache35_53() const { return ___U3CU3Ef__mgU24cache35_53; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache35_53() { return &___U3CU3Ef__mgU24cache35_53; }
- inline void set_U3CU3Ef__mgU24cache35_53(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache35_53 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache35_53), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache36_54() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache36_54)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache36_54() const { return ___U3CU3Ef__mgU24cache36_54; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache36_54() { return &___U3CU3Ef__mgU24cache36_54; }
- inline void set_U3CU3Ef__mgU24cache36_54(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache36_54 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache36_54), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache37_55() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache37_55)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache37_55() const { return ___U3CU3Ef__mgU24cache37_55; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache37_55() { return &___U3CU3Ef__mgU24cache37_55; }
- inline void set_U3CU3Ef__mgU24cache37_55(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache37_55 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache37_55), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache38_56() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache38_56)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache38_56() const { return ___U3CU3Ef__mgU24cache38_56; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache38_56() { return &___U3CU3Ef__mgU24cache38_56; }
- inline void set_U3CU3Ef__mgU24cache38_56(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache38_56 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache38_56), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache39_57() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache39_57)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache39_57() const { return ___U3CU3Ef__mgU24cache39_57; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache39_57() { return &___U3CU3Ef__mgU24cache39_57; }
- inline void set_U3CU3Ef__mgU24cache39_57(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache39_57 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache39_57), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3A_58() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3A_58)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3A_58() const { return ___U3CU3Ef__mgU24cache3A_58; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3A_58() { return &___U3CU3Ef__mgU24cache3A_58; }
- inline void set_U3CU3Ef__mgU24cache3A_58(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3A_58 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3A_58), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3B_59() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3B_59)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3B_59() const { return ___U3CU3Ef__mgU24cache3B_59; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3B_59() { return &___U3CU3Ef__mgU24cache3B_59; }
- inline void set_U3CU3Ef__mgU24cache3B_59(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3B_59 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3B_59), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3C_60() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3C_60)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3C_60() const { return ___U3CU3Ef__mgU24cache3C_60; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3C_60() { return &___U3CU3Ef__mgU24cache3C_60; }
- inline void set_U3CU3Ef__mgU24cache3C_60(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3C_60 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3C_60), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3D_61() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3D_61)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3D_61() const { return ___U3CU3Ef__mgU24cache3D_61; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3D_61() { return &___U3CU3Ef__mgU24cache3D_61; }
- inline void set_U3CU3Ef__mgU24cache3D_61(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3D_61 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3D_61), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3E_62() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3E_62)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3E_62() const { return ___U3CU3Ef__mgU24cache3E_62; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3E_62() { return &___U3CU3Ef__mgU24cache3E_62; }
- inline void set_U3CU3Ef__mgU24cache3E_62(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3E_62 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3E_62), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3F_63() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache3F_63)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3F_63() const { return ___U3CU3Ef__mgU24cache3F_63; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3F_63() { return &___U3CU3Ef__mgU24cache3F_63; }
- inline void set_U3CU3Ef__mgU24cache3F_63(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3F_63 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3F_63), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache40_64() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache40_64)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache40_64() const { return ___U3CU3Ef__mgU24cache40_64; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache40_64() { return &___U3CU3Ef__mgU24cache40_64; }
- inline void set_U3CU3Ef__mgU24cache40_64(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache40_64 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache40_64), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache41_65() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache41_65)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache41_65() const { return ___U3CU3Ef__mgU24cache41_65; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache41_65() { return &___U3CU3Ef__mgU24cache41_65; }
- inline void set_U3CU3Ef__mgU24cache41_65(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache41_65 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache41_65), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache42_66() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache42_66)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache42_66() const { return ___U3CU3Ef__mgU24cache42_66; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache42_66() { return &___U3CU3Ef__mgU24cache42_66; }
- inline void set_U3CU3Ef__mgU24cache42_66(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache42_66 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache42_66), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache43_67() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache43_67)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache43_67() const { return ___U3CU3Ef__mgU24cache43_67; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache43_67() { return &___U3CU3Ef__mgU24cache43_67; }
- inline void set_U3CU3Ef__mgU24cache43_67(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache43_67 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache43_67), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache44_68() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache44_68)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache44_68() const { return ___U3CU3Ef__mgU24cache44_68; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache44_68() { return &___U3CU3Ef__mgU24cache44_68; }
- inline void set_U3CU3Ef__mgU24cache44_68(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache44_68 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache44_68), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache45_69() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache45_69)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache45_69() const { return ___U3CU3Ef__mgU24cache45_69; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache45_69() { return &___U3CU3Ef__mgU24cache45_69; }
- inline void set_U3CU3Ef__mgU24cache45_69(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache45_69 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache45_69), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache46_70() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache46_70)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache46_70() const { return ___U3CU3Ef__mgU24cache46_70; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache46_70() { return &___U3CU3Ef__mgU24cache46_70; }
- inline void set_U3CU3Ef__mgU24cache46_70(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache46_70 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache46_70), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache47_71() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache47_71)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache47_71() const { return ___U3CU3Ef__mgU24cache47_71; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache47_71() { return &___U3CU3Ef__mgU24cache47_71; }
- inline void set_U3CU3Ef__mgU24cache47_71(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache47_71 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache47_71), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache48_72() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache48_72)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache48_72() const { return ___U3CU3Ef__mgU24cache48_72; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache48_72() { return &___U3CU3Ef__mgU24cache48_72; }
- inline void set_U3CU3Ef__mgU24cache48_72(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache48_72 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache48_72), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache49_73() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache49_73)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache49_73() const { return ___U3CU3Ef__mgU24cache49_73; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache49_73() { return &___U3CU3Ef__mgU24cache49_73; }
- inline void set_U3CU3Ef__mgU24cache49_73(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache49_73 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache49_73), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4A_74() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4A_74)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4A_74() const { return ___U3CU3Ef__mgU24cache4A_74; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4A_74() { return &___U3CU3Ef__mgU24cache4A_74; }
- inline void set_U3CU3Ef__mgU24cache4A_74(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4A_74 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4A_74), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4B_75() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4B_75)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4B_75() const { return ___U3CU3Ef__mgU24cache4B_75; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4B_75() { return &___U3CU3Ef__mgU24cache4B_75; }
- inline void set_U3CU3Ef__mgU24cache4B_75(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4B_75 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4B_75), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4C_76() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4C_76)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4C_76() const { return ___U3CU3Ef__mgU24cache4C_76; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4C_76() { return &___U3CU3Ef__mgU24cache4C_76; }
- inline void set_U3CU3Ef__mgU24cache4C_76(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4C_76 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4C_76), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4D_77() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4D_77)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4D_77() const { return ___U3CU3Ef__mgU24cache4D_77; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4D_77() { return &___U3CU3Ef__mgU24cache4D_77; }
- inline void set_U3CU3Ef__mgU24cache4D_77(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4D_77 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4D_77), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4E_78() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4E_78)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4E_78() const { return ___U3CU3Ef__mgU24cache4E_78; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4E_78() { return &___U3CU3Ef__mgU24cache4E_78; }
- inline void set_U3CU3Ef__mgU24cache4E_78(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4E_78 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4E_78), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4F_79() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache4F_79)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4F_79() const { return ___U3CU3Ef__mgU24cache4F_79; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4F_79() { return &___U3CU3Ef__mgU24cache4F_79; }
- inline void set_U3CU3Ef__mgU24cache4F_79(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4F_79 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4F_79), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache50_80() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache50_80)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache50_80() const { return ___U3CU3Ef__mgU24cache50_80; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache50_80() { return &___U3CU3Ef__mgU24cache50_80; }
- inline void set_U3CU3Ef__mgU24cache50_80(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache50_80 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache50_80), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache51_81() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache51_81)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache51_81() const { return ___U3CU3Ef__mgU24cache51_81; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache51_81() { return &___U3CU3Ef__mgU24cache51_81; }
- inline void set_U3CU3Ef__mgU24cache51_81(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache51_81 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache51_81), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache52_82() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache52_82)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache52_82() const { return ___U3CU3Ef__mgU24cache52_82; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache52_82() { return &___U3CU3Ef__mgU24cache52_82; }
- inline void set_U3CU3Ef__mgU24cache52_82(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache52_82 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache52_82), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache53_83() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache53_83)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache53_83() const { return ___U3CU3Ef__mgU24cache53_83; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache53_83() { return &___U3CU3Ef__mgU24cache53_83; }
- inline void set_U3CU3Ef__mgU24cache53_83(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache53_83 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache53_83), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache54_84() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache54_84)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache54_84() const { return ___U3CU3Ef__mgU24cache54_84; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache54_84() { return &___U3CU3Ef__mgU24cache54_84; }
- inline void set_U3CU3Ef__mgU24cache54_84(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache54_84 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache54_84), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache55_85() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache55_85)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache55_85() const { return ___U3CU3Ef__mgU24cache55_85; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache55_85() { return &___U3CU3Ef__mgU24cache55_85; }
- inline void set_U3CU3Ef__mgU24cache55_85(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache55_85 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache55_85), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache56_86() { return static_cast<int32_t>(offsetof(UnityEngineTransformWrap_t3488644103_StaticFields, ___U3CU3Ef__mgU24cache56_86)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache56_86() const { return ___U3CU3Ef__mgU24cache56_86; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache56_86() { return &___U3CU3Ef__mgU24cache56_86; }
- inline void set_U3CU3Ef__mgU24cache56_86(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache56_86 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache56_86), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UNITYENGINETRANSFORMWRAP_T3488644103_H
- #ifndef UNITYENGINEVECTOR2WRAP_T2602506976_H
- #define UNITYENGINEVECTOR2WRAP_T2602506976_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.CSObjectWrap.UnityEngineVector2Wrap
- struct UnityEngineVector2Wrap_t2602506976 : public RuntimeObject
- {
- public:
- public:
- };
- struct UnityEngineVector2Wrap_t2602506976_StaticFields
- {
- public:
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_0;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_1;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_2;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_3;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache4
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4_4;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache5
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache5_5;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache6
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache6_6;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache7
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache7_7;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache8
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache8_8;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache9
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache9_9;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cacheA
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheA_10;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cacheB
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheB_11;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cacheC
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheC_12;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cacheD
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheD_13;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cacheE
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheE_14;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cacheF
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheF_15;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache10
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache10_16;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache11
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache11_17;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache12
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache12_18;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache13
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache13_19;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache14
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache14_20;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache15
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache15_21;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache16
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache16_22;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache17
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache17_23;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache18
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache18_24;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache19
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache19_25;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1A
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1A_26;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1B
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1B_27;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1C
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1C_28;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1D
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1D_29;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1E
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1E_30;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache1F
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1F_31;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache20
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache20_32;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache21
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache21_33;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache22
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache22_34;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache23
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache23_35;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache24
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache24_36;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache25
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache25_37;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache26
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache26_38;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache27
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache27_39;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache28
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache28_40;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache29
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache29_41;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache2A
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2A_42;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache2B
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2B_43;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineVector2Wrap::<>f__mg$cache2C
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2C_44;
- public:
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_0() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache0_0)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_0() const { return ___U3CU3Ef__mgU24cache0_0; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_0() { return &___U3CU3Ef__mgU24cache0_0; }
- inline void set_U3CU3Ef__mgU24cache0_0(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_0 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_0), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_1() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1_1)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_1() const { return ___U3CU3Ef__mgU24cache1_1; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_1() { return &___U3CU3Ef__mgU24cache1_1; }
- inline void set_U3CU3Ef__mgU24cache1_1(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_1 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_1), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_2() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache2_2)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_2() const { return ___U3CU3Ef__mgU24cache2_2; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_2() { return &___U3CU3Ef__mgU24cache2_2; }
- inline void set_U3CU3Ef__mgU24cache2_2(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_2 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_2), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_3() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache3_3)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_3() const { return ___U3CU3Ef__mgU24cache3_3; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_3() { return &___U3CU3Ef__mgU24cache3_3; }
- inline void set_U3CU3Ef__mgU24cache3_3(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_3 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_3), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4_4() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache4_4)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4_4() const { return ___U3CU3Ef__mgU24cache4_4; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4_4() { return &___U3CU3Ef__mgU24cache4_4; }
- inline void set_U3CU3Ef__mgU24cache4_4(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4_4 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4_4), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache5_5() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache5_5)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache5_5() const { return ___U3CU3Ef__mgU24cache5_5; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache5_5() { return &___U3CU3Ef__mgU24cache5_5; }
- inline void set_U3CU3Ef__mgU24cache5_5(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache5_5 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache5_5), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache6_6() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache6_6)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache6_6() const { return ___U3CU3Ef__mgU24cache6_6; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache6_6() { return &___U3CU3Ef__mgU24cache6_6; }
- inline void set_U3CU3Ef__mgU24cache6_6(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache6_6 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache6_6), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache7_7() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache7_7)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache7_7() const { return ___U3CU3Ef__mgU24cache7_7; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache7_7() { return &___U3CU3Ef__mgU24cache7_7; }
- inline void set_U3CU3Ef__mgU24cache7_7(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache7_7 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache7_7), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache8_8() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache8_8)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache8_8() const { return ___U3CU3Ef__mgU24cache8_8; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache8_8() { return &___U3CU3Ef__mgU24cache8_8; }
- inline void set_U3CU3Ef__mgU24cache8_8(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache8_8 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache8_8), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache9_9() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache9_9)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache9_9() const { return ___U3CU3Ef__mgU24cache9_9; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache9_9() { return &___U3CU3Ef__mgU24cache9_9; }
- inline void set_U3CU3Ef__mgU24cache9_9(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache9_9 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache9_9), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheA_10() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cacheA_10)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheA_10() const { return ___U3CU3Ef__mgU24cacheA_10; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheA_10() { return &___U3CU3Ef__mgU24cacheA_10; }
- inline void set_U3CU3Ef__mgU24cacheA_10(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheA_10 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheA_10), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheB_11() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cacheB_11)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheB_11() const { return ___U3CU3Ef__mgU24cacheB_11; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheB_11() { return &___U3CU3Ef__mgU24cacheB_11; }
- inline void set_U3CU3Ef__mgU24cacheB_11(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheB_11 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheB_11), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheC_12() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cacheC_12)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheC_12() const { return ___U3CU3Ef__mgU24cacheC_12; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheC_12() { return &___U3CU3Ef__mgU24cacheC_12; }
- inline void set_U3CU3Ef__mgU24cacheC_12(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheC_12 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheC_12), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheD_13() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cacheD_13)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheD_13() const { return ___U3CU3Ef__mgU24cacheD_13; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheD_13() { return &___U3CU3Ef__mgU24cacheD_13; }
- inline void set_U3CU3Ef__mgU24cacheD_13(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheD_13 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheD_13), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheE_14() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cacheE_14)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheE_14() const { return ___U3CU3Ef__mgU24cacheE_14; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheE_14() { return &___U3CU3Ef__mgU24cacheE_14; }
- inline void set_U3CU3Ef__mgU24cacheE_14(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheE_14 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheE_14), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheF_15() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cacheF_15)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheF_15() const { return ___U3CU3Ef__mgU24cacheF_15; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheF_15() { return &___U3CU3Ef__mgU24cacheF_15; }
- inline void set_U3CU3Ef__mgU24cacheF_15(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheF_15 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheF_15), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache10_16() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache10_16)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache10_16() const { return ___U3CU3Ef__mgU24cache10_16; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache10_16() { return &___U3CU3Ef__mgU24cache10_16; }
- inline void set_U3CU3Ef__mgU24cache10_16(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache10_16 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache10_16), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache11_17() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache11_17)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache11_17() const { return ___U3CU3Ef__mgU24cache11_17; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache11_17() { return &___U3CU3Ef__mgU24cache11_17; }
- inline void set_U3CU3Ef__mgU24cache11_17(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache11_17 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache11_17), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache12_18() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache12_18)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache12_18() const { return ___U3CU3Ef__mgU24cache12_18; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache12_18() { return &___U3CU3Ef__mgU24cache12_18; }
- inline void set_U3CU3Ef__mgU24cache12_18(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache12_18 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache12_18), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache13_19() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache13_19)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache13_19() const { return ___U3CU3Ef__mgU24cache13_19; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache13_19() { return &___U3CU3Ef__mgU24cache13_19; }
- inline void set_U3CU3Ef__mgU24cache13_19(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache13_19 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache13_19), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache14_20() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache14_20)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache14_20() const { return ___U3CU3Ef__mgU24cache14_20; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache14_20() { return &___U3CU3Ef__mgU24cache14_20; }
- inline void set_U3CU3Ef__mgU24cache14_20(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache14_20 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache14_20), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache15_21() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache15_21)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache15_21() const { return ___U3CU3Ef__mgU24cache15_21; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache15_21() { return &___U3CU3Ef__mgU24cache15_21; }
- inline void set_U3CU3Ef__mgU24cache15_21(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache15_21 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache15_21), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache16_22() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache16_22)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache16_22() const { return ___U3CU3Ef__mgU24cache16_22; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache16_22() { return &___U3CU3Ef__mgU24cache16_22; }
- inline void set_U3CU3Ef__mgU24cache16_22(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache16_22 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache16_22), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache17_23() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache17_23)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache17_23() const { return ___U3CU3Ef__mgU24cache17_23; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache17_23() { return &___U3CU3Ef__mgU24cache17_23; }
- inline void set_U3CU3Ef__mgU24cache17_23(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache17_23 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache17_23), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache18_24() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache18_24)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache18_24() const { return ___U3CU3Ef__mgU24cache18_24; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache18_24() { return &___U3CU3Ef__mgU24cache18_24; }
- inline void set_U3CU3Ef__mgU24cache18_24(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache18_24 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache18_24), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache19_25() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache19_25)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache19_25() const { return ___U3CU3Ef__mgU24cache19_25; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache19_25() { return &___U3CU3Ef__mgU24cache19_25; }
- inline void set_U3CU3Ef__mgU24cache19_25(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache19_25 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache19_25), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1A_26() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1A_26)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1A_26() const { return ___U3CU3Ef__mgU24cache1A_26; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1A_26() { return &___U3CU3Ef__mgU24cache1A_26; }
- inline void set_U3CU3Ef__mgU24cache1A_26(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1A_26 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1A_26), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1B_27() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1B_27)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1B_27() const { return ___U3CU3Ef__mgU24cache1B_27; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1B_27() { return &___U3CU3Ef__mgU24cache1B_27; }
- inline void set_U3CU3Ef__mgU24cache1B_27(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1B_27 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1B_27), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1C_28() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1C_28)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1C_28() const { return ___U3CU3Ef__mgU24cache1C_28; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1C_28() { return &___U3CU3Ef__mgU24cache1C_28; }
- inline void set_U3CU3Ef__mgU24cache1C_28(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1C_28 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1C_28), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1D_29() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1D_29)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1D_29() const { return ___U3CU3Ef__mgU24cache1D_29; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1D_29() { return &___U3CU3Ef__mgU24cache1D_29; }
- inline void set_U3CU3Ef__mgU24cache1D_29(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1D_29 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1D_29), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1E_30() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1E_30)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1E_30() const { return ___U3CU3Ef__mgU24cache1E_30; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1E_30() { return &___U3CU3Ef__mgU24cache1E_30; }
- inline void set_U3CU3Ef__mgU24cache1E_30(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1E_30 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1E_30), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1F_31() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache1F_31)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1F_31() const { return ___U3CU3Ef__mgU24cache1F_31; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1F_31() { return &___U3CU3Ef__mgU24cache1F_31; }
- inline void set_U3CU3Ef__mgU24cache1F_31(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1F_31 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1F_31), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache20_32() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache20_32)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache20_32() const { return ___U3CU3Ef__mgU24cache20_32; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache20_32() { return &___U3CU3Ef__mgU24cache20_32; }
- inline void set_U3CU3Ef__mgU24cache20_32(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache20_32 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache20_32), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache21_33() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache21_33)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache21_33() const { return ___U3CU3Ef__mgU24cache21_33; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache21_33() { return &___U3CU3Ef__mgU24cache21_33; }
- inline void set_U3CU3Ef__mgU24cache21_33(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache21_33 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache21_33), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache22_34() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache22_34)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache22_34() const { return ___U3CU3Ef__mgU24cache22_34; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache22_34() { return &___U3CU3Ef__mgU24cache22_34; }
- inline void set_U3CU3Ef__mgU24cache22_34(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache22_34 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache22_34), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache23_35() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache23_35)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache23_35() const { return ___U3CU3Ef__mgU24cache23_35; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache23_35() { return &___U3CU3Ef__mgU24cache23_35; }
- inline void set_U3CU3Ef__mgU24cache23_35(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache23_35 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache23_35), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache24_36() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache24_36)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache24_36() const { return ___U3CU3Ef__mgU24cache24_36; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache24_36() { return &___U3CU3Ef__mgU24cache24_36; }
- inline void set_U3CU3Ef__mgU24cache24_36(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache24_36 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache24_36), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache25_37() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache25_37)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache25_37() const { return ___U3CU3Ef__mgU24cache25_37; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache25_37() { return &___U3CU3Ef__mgU24cache25_37; }
- inline void set_U3CU3Ef__mgU24cache25_37(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache25_37 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache25_37), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache26_38() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache26_38)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache26_38() const { return ___U3CU3Ef__mgU24cache26_38; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache26_38() { return &___U3CU3Ef__mgU24cache26_38; }
- inline void set_U3CU3Ef__mgU24cache26_38(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache26_38 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache26_38), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache27_39() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache27_39)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache27_39() const { return ___U3CU3Ef__mgU24cache27_39; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache27_39() { return &___U3CU3Ef__mgU24cache27_39; }
- inline void set_U3CU3Ef__mgU24cache27_39(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache27_39 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache27_39), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache28_40() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache28_40)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache28_40() const { return ___U3CU3Ef__mgU24cache28_40; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache28_40() { return &___U3CU3Ef__mgU24cache28_40; }
- inline void set_U3CU3Ef__mgU24cache28_40(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache28_40 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache28_40), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache29_41() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache29_41)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache29_41() const { return ___U3CU3Ef__mgU24cache29_41; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache29_41() { return &___U3CU3Ef__mgU24cache29_41; }
- inline void set_U3CU3Ef__mgU24cache29_41(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache29_41 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache29_41), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2A_42() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache2A_42)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2A_42() const { return ___U3CU3Ef__mgU24cache2A_42; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2A_42() { return &___U3CU3Ef__mgU24cache2A_42; }
- inline void set_U3CU3Ef__mgU24cache2A_42(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2A_42 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2A_42), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2B_43() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache2B_43)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2B_43() const { return ___U3CU3Ef__mgU24cache2B_43; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2B_43() { return &___U3CU3Ef__mgU24cache2B_43; }
- inline void set_U3CU3Ef__mgU24cache2B_43(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2B_43 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2B_43), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2C_44() { return static_cast<int32_t>(offsetof(UnityEngineVector2Wrap_t2602506976_StaticFields, ___U3CU3Ef__mgU24cache2C_44)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2C_44() const { return ___U3CU3Ef__mgU24cache2C_44; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2C_44() { return &___U3CU3Ef__mgU24cache2C_44; }
- inline void set_U3CU3Ef__mgU24cache2C_44(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2C_44 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2C_44), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UNITYENGINEVECTOR2WRAP_T2602506976_H
- #ifndef RESOURCES_T2942265397_H
- #define RESOURCES_T2942265397_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Resources
- struct Resources_t2942265397 : public RuntimeObject
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // RESOURCES_T2942265397_H
- #ifndef UNITYENGINERESOURCESWRAP_T3776895103_H
- #define UNITYENGINERESOURCESWRAP_T3776895103_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.CSObjectWrap.UnityEngineResourcesWrap
- struct UnityEngineResourcesWrap_t3776895103 : public RuntimeObject
- {
- public:
- public:
- };
- struct UnityEngineResourcesWrap_t3776895103_StaticFields
- {
- public:
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_0;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_1;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_2;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_3;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache4
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4_4;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache5
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache5_5;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache6
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache6_6;
- // XLua.LuaDLL.lua_CSFunction XLua.CSObjectWrap.UnityEngineResourcesWrap::<>f__mg$cache7
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache7_7;
- public:
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_0() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache0_0)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_0() const { return ___U3CU3Ef__mgU24cache0_0; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_0() { return &___U3CU3Ef__mgU24cache0_0; }
- inline void set_U3CU3Ef__mgU24cache0_0(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_0 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_0), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_1() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache1_1)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_1() const { return ___U3CU3Ef__mgU24cache1_1; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_1() { return &___U3CU3Ef__mgU24cache1_1; }
- inline void set_U3CU3Ef__mgU24cache1_1(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_1 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_1), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_2() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache2_2)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_2() const { return ___U3CU3Ef__mgU24cache2_2; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_2() { return &___U3CU3Ef__mgU24cache2_2; }
- inline void set_U3CU3Ef__mgU24cache2_2(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_2 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_2), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_3() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache3_3)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_3() const { return ___U3CU3Ef__mgU24cache3_3; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_3() { return &___U3CU3Ef__mgU24cache3_3; }
- inline void set_U3CU3Ef__mgU24cache3_3(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_3 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_3), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4_4() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache4_4)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4_4() const { return ___U3CU3Ef__mgU24cache4_4; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4_4() { return &___U3CU3Ef__mgU24cache4_4; }
- inline void set_U3CU3Ef__mgU24cache4_4(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4_4 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4_4), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache5_5() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache5_5)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache5_5() const { return ___U3CU3Ef__mgU24cache5_5; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache5_5() { return &___U3CU3Ef__mgU24cache5_5; }
- inline void set_U3CU3Ef__mgU24cache5_5(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache5_5 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache5_5), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache6_6() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache6_6)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache6_6() const { return ___U3CU3Ef__mgU24cache6_6; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache6_6() { return &___U3CU3Ef__mgU24cache6_6; }
- inline void set_U3CU3Ef__mgU24cache6_6(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache6_6 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache6_6), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache7_7() { return static_cast<int32_t>(offsetof(UnityEngineResourcesWrap_t3776895103_StaticFields, ___U3CU3Ef__mgU24cache7_7)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache7_7() const { return ___U3CU3Ef__mgU24cache7_7; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache7_7() { return &___U3CU3Ef__mgU24cache7_7; }
- inline void set_U3CU3Ef__mgU24cache7_7(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache7_7 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache7_7), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UNITYENGINERESOURCESWRAP_T3776895103_H
- #ifndef OBJECTTRANSLATOR_T2020767555_H
- #define OBJECTTRANSLATOR_T2020767555_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.ObjectTranslator
- struct ObjectTranslator_t2020767555 : public RuntimeObject
- {
- public:
- // XLua.MethodWrapsCache XLua.ObjectTranslator::methodWrapsCache
- MethodWrapsCache_t113059333 * ___methodWrapsCache_0;
- // XLua.ObjectCheckers XLua.ObjectTranslator::objectCheckers
- ObjectCheckers_t1922409879 * ___objectCheckers_1;
- // XLua.ObjectCasters XLua.ObjectTranslator::objectCasters
- ObjectCasters_t3722364209 * ___objectCasters_2;
- // XLua.ObjectPool XLua.ObjectTranslator::objects
- ObjectPool_t1928582859 * ___objects_3;
- // System.Collections.Generic.Dictionary`2<System.Object,System.Int32> XLua.ObjectTranslator::reverseMap
- Dictionary_2_t3384741 * ___reverseMap_4;
- // XLua.LuaEnv XLua.ObjectTranslator::luaEnv
- LuaEnv_t2152703515 * ___luaEnv_5;
- // XLua.StaticLuaCallbacks XLua.ObjectTranslator::metaFunctions
- StaticLuaCallbacks_t3406648379 * ___metaFunctions_6;
- // System.Collections.Generic.List`1<System.Reflection.Assembly> XLua.ObjectTranslator::assemblies
- List_1_t1279540245 * ___assemblies_7;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::importTypeFunction
- lua_CSFunction_t883524059 * ___importTypeFunction_8;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::loadAssemblyFunction
- lua_CSFunction_t883524059 * ___loadAssemblyFunction_9;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::castFunction
- lua_CSFunction_t883524059 * ___castFunction_10;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Action`1<System.IntPtr>> XLua.ObjectTranslator::delayWrap
- Dictionary_2_t3456964840 * ___delayWrap_11;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Func`3<System.Int32,XLua.LuaEnv,XLua.LuaBase>> XLua.ObjectTranslator::interfaceBridgeCreators
- Dictionary_2_t1325155278 * ___interfaceBridgeCreators_12;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Type> XLua.ObjectTranslator::aliasCfg
- Dictionary_2_t633324528 * ___aliasCfg_13;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Boolean> XLua.ObjectTranslator::loaded_types
- Dictionary_2_t2541635029 * ___loaded_types_14;
- // System.Int32 XLua.ObjectTranslator::cacheRef
- int32_t ___cacheRef_15;
- // System.Reflection.MethodInfo[] XLua.ObjectTranslator::genericAction
- MethodInfoU5BU5D_t2572182361* ___genericAction_16;
- // System.Reflection.MethodInfo[] XLua.ObjectTranslator::genericFunc
- MethodInfoU5BU5D_t2572182361* ___genericFunc_17;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Func`2<XLua.DelegateBridgeBase,System.Delegate>> XLua.ObjectTranslator::delegateCreatorCache
- Dictionary_2_t3427006295 * ___delegateCreatorCache_18;
- // System.Collections.Generic.Dictionary`2<System.Int32,System.WeakReference> XLua.ObjectTranslator::delegate_bridges
- Dictionary_2_t223600047 * ___delegate_bridges_19;
- // System.Int32 XLua.ObjectTranslator::common_array_meta
- int32_t ___common_array_meta_20;
- // System.Int32 XLua.ObjectTranslator::common_delegate_meta
- int32_t ___common_delegate_meta_21;
- // System.Int32 XLua.ObjectTranslator::enumerable_pairs_func
- int32_t ___enumerable_pairs_func_22;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Int32> XLua.ObjectTranslator::typeIdMap
- Dictionary_2_t1100325521 * ___typeIdMap_23;
- // System.Collections.Generic.Dictionary`2<System.Int32,System.Type> XLua.ObjectTranslator::typeMap
- Dictionary_2_t1372658091 * ___typeMap_24;
- // System.Collections.Generic.HashSet`1<System.Type> XLua.ObjectTranslator::privateAccessibleFlags
- HashSet_1_t1048894234 * ___privateAccessibleFlags_25;
- // System.Collections.Generic.Dictionary`2<System.Object,System.Int32> XLua.ObjectTranslator::enumMap
- Dictionary_2_t3384741 * ___enumMap_26;
- // System.Collections.Generic.List`1<XLua.LuaDLL.lua_CSFunction> XLua.ObjectTranslator::fix_cs_functions
- List_1_t2355598801 * ___fix_cs_functions_27;
- // System.Collections.Generic.Dictionary`2<System.Type,XLua.ObjectTranslator/PushCSObject> XLua.ObjectTranslator::custom_push_funcs
- Dictionary_2_t974727102 * ___custom_push_funcs_28;
- // System.Collections.Generic.Dictionary`2<System.Type,XLua.ObjectTranslator/GetCSObject> XLua.ObjectTranslator::custom_get_funcs
- Dictionary_2_t3199299591 * ___custom_get_funcs_29;
- // System.Collections.Generic.Dictionary`2<System.Type,XLua.ObjectTranslator/UpdateCSObject> XLua.ObjectTranslator::custom_update_funcs
- Dictionary_2_t2411574205 * ___custom_update_funcs_30;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Delegate> XLua.ObjectTranslator::push_func_with_type
- Dictionary_2_t3632739877 * ___push_func_with_type_31;
- // System.Collections.Generic.Dictionary`2<System.Type,System.Delegate> XLua.ObjectTranslator::get_func_with_type
- Dictionary_2_t3632739877 * ___get_func_with_type_32;
- // System.Int32 XLua.ObjectTranslator::decimal_type_id
- int32_t ___decimal_type_id_33;
- // System.Int32 XLua.ObjectTranslator::XLuaTestPedding_TypeID
- int32_t ___XLuaTestPedding_TypeID_35;
- // System.Int32 XLua.ObjectTranslator::XLuaTestMyStruct_TypeID
- int32_t ___XLuaTestMyStruct_TypeID_36;
- // System.Int32 XLua.ObjectTranslator::XLuaTestPushAsTableStruct_TypeID
- int32_t ___XLuaTestPushAsTableStruct_TypeID_37;
- // System.Int32 XLua.ObjectTranslator::UnityEngineVector2_TypeID
- int32_t ___UnityEngineVector2_TypeID_38;
- // System.Int32 XLua.ObjectTranslator::UnityEngineVector3_TypeID
- int32_t ___UnityEngineVector3_TypeID_39;
- // System.Int32 XLua.ObjectTranslator::UnityEngineVector4_TypeID
- int32_t ___UnityEngineVector4_TypeID_40;
- // System.Int32 XLua.ObjectTranslator::UnityEngineColor_TypeID
- int32_t ___UnityEngineColor_TypeID_41;
- // System.Int32 XLua.ObjectTranslator::UnityEngineQuaternion_TypeID
- int32_t ___UnityEngineQuaternion_TypeID_42;
- // System.Int32 XLua.ObjectTranslator::UnityEngineRay_TypeID
- int32_t ___UnityEngineRay_TypeID_43;
- // System.Int32 XLua.ObjectTranslator::UnityEngineBounds_TypeID
- int32_t ___UnityEngineBounds_TypeID_44;
- // System.Int32 XLua.ObjectTranslator::UnityEngineRay2D_TypeID
- int32_t ___UnityEngineRay2D_TypeID_45;
- // System.Int32 XLua.ObjectTranslator::DGTweeningAutoPlay_TypeID
- int32_t ___DGTweeningAutoPlay_TypeID_46;
- // System.Int32 XLua.ObjectTranslator::DGTweeningAutoPlay_EnumRef
- int32_t ___DGTweeningAutoPlay_EnumRef_47;
- // System.Int32 XLua.ObjectTranslator::DGTweeningAxisConstraint_TypeID
- int32_t ___DGTweeningAxisConstraint_TypeID_48;
- // System.Int32 XLua.ObjectTranslator::DGTweeningAxisConstraint_EnumRef
- int32_t ___DGTweeningAxisConstraint_EnumRef_49;
- // System.Int32 XLua.ObjectTranslator::DGTweeningEase_TypeID
- int32_t ___DGTweeningEase_TypeID_50;
- // System.Int32 XLua.ObjectTranslator::DGTweeningEase_EnumRef
- int32_t ___DGTweeningEase_EnumRef_51;
- // System.Int32 XLua.ObjectTranslator::DGTweeningLogBehaviour_TypeID
- int32_t ___DGTweeningLogBehaviour_TypeID_52;
- // System.Int32 XLua.ObjectTranslator::DGTweeningLogBehaviour_EnumRef
- int32_t ___DGTweeningLogBehaviour_EnumRef_53;
- // System.Int32 XLua.ObjectTranslator::DGTweeningLoopType_TypeID
- int32_t ___DGTweeningLoopType_TypeID_54;
- // System.Int32 XLua.ObjectTranslator::DGTweeningLoopType_EnumRef
- int32_t ___DGTweeningLoopType_EnumRef_55;
- // System.Int32 XLua.ObjectTranslator::DGTweeningPathMode_TypeID
- int32_t ___DGTweeningPathMode_TypeID_56;
- // System.Int32 XLua.ObjectTranslator::DGTweeningPathMode_EnumRef
- int32_t ___DGTweeningPathMode_EnumRef_57;
- // System.Int32 XLua.ObjectTranslator::DGTweeningPathType_TypeID
- int32_t ___DGTweeningPathType_TypeID_58;
- // System.Int32 XLua.ObjectTranslator::DGTweeningPathType_EnumRef
- int32_t ___DGTweeningPathType_EnumRef_59;
- // System.Int32 XLua.ObjectTranslator::DGTweeningRotateMode_TypeID
- int32_t ___DGTweeningRotateMode_TypeID_60;
- // System.Int32 XLua.ObjectTranslator::DGTweeningRotateMode_EnumRef
- int32_t ___DGTweeningRotateMode_EnumRef_61;
- // System.Int32 XLua.ObjectTranslator::DGTweeningScrambleMode_TypeID
- int32_t ___DGTweeningScrambleMode_TypeID_62;
- // System.Int32 XLua.ObjectTranslator::DGTweeningScrambleMode_EnumRef
- int32_t ___DGTweeningScrambleMode_EnumRef_63;
- // System.Int32 XLua.ObjectTranslator::DGTweeningTweenType_TypeID
- int32_t ___DGTweeningTweenType_TypeID_64;
- // System.Int32 XLua.ObjectTranslator::DGTweeningTweenType_EnumRef
- int32_t ___DGTweeningTweenType_EnumRef_65;
- // System.Int32 XLua.ObjectTranslator::DGTweeningUpdateType_TypeID
- int32_t ___DGTweeningUpdateType_TypeID_66;
- // System.Int32 XLua.ObjectTranslator::DGTweeningUpdateType_EnumRef
- int32_t ___DGTweeningUpdateType_EnumRef_67;
- // System.Int32 XLua.ObjectTranslator::XLuaTestMyEnum_TypeID
- int32_t ___XLuaTestMyEnum_TypeID_68;
- // System.Int32 XLua.ObjectTranslator::XLuaTestMyEnum_EnumRef
- int32_t ___XLuaTestMyEnum_EnumRef_69;
- public:
- inline static int32_t get_offset_of_methodWrapsCache_0() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___methodWrapsCache_0)); }
- inline MethodWrapsCache_t113059333 * get_methodWrapsCache_0() const { return ___methodWrapsCache_0; }
- inline MethodWrapsCache_t113059333 ** get_address_of_methodWrapsCache_0() { return &___methodWrapsCache_0; }
- inline void set_methodWrapsCache_0(MethodWrapsCache_t113059333 * value)
- {
- ___methodWrapsCache_0 = value;
- Il2CppCodeGenWriteBarrier((&___methodWrapsCache_0), value);
- }
- inline static int32_t get_offset_of_objectCheckers_1() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___objectCheckers_1)); }
- inline ObjectCheckers_t1922409879 * get_objectCheckers_1() const { return ___objectCheckers_1; }
- inline ObjectCheckers_t1922409879 ** get_address_of_objectCheckers_1() { return &___objectCheckers_1; }
- inline void set_objectCheckers_1(ObjectCheckers_t1922409879 * value)
- {
- ___objectCheckers_1 = value;
- Il2CppCodeGenWriteBarrier((&___objectCheckers_1), value);
- }
- inline static int32_t get_offset_of_objectCasters_2() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___objectCasters_2)); }
- inline ObjectCasters_t3722364209 * get_objectCasters_2() const { return ___objectCasters_2; }
- inline ObjectCasters_t3722364209 ** get_address_of_objectCasters_2() { return &___objectCasters_2; }
- inline void set_objectCasters_2(ObjectCasters_t3722364209 * value)
- {
- ___objectCasters_2 = value;
- Il2CppCodeGenWriteBarrier((&___objectCasters_2), value);
- }
- inline static int32_t get_offset_of_objects_3() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___objects_3)); }
- inline ObjectPool_t1928582859 * get_objects_3() const { return ___objects_3; }
- inline ObjectPool_t1928582859 ** get_address_of_objects_3() { return &___objects_3; }
- inline void set_objects_3(ObjectPool_t1928582859 * value)
- {
- ___objects_3 = value;
- Il2CppCodeGenWriteBarrier((&___objects_3), value);
- }
- inline static int32_t get_offset_of_reverseMap_4() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___reverseMap_4)); }
- inline Dictionary_2_t3384741 * get_reverseMap_4() const { return ___reverseMap_4; }
- inline Dictionary_2_t3384741 ** get_address_of_reverseMap_4() { return &___reverseMap_4; }
- inline void set_reverseMap_4(Dictionary_2_t3384741 * value)
- {
- ___reverseMap_4 = value;
- Il2CppCodeGenWriteBarrier((&___reverseMap_4), value);
- }
- inline static int32_t get_offset_of_luaEnv_5() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___luaEnv_5)); }
- inline LuaEnv_t2152703515 * get_luaEnv_5() const { return ___luaEnv_5; }
- inline LuaEnv_t2152703515 ** get_address_of_luaEnv_5() { return &___luaEnv_5; }
- inline void set_luaEnv_5(LuaEnv_t2152703515 * value)
- {
- ___luaEnv_5 = value;
- Il2CppCodeGenWriteBarrier((&___luaEnv_5), value);
- }
- inline static int32_t get_offset_of_metaFunctions_6() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___metaFunctions_6)); }
- inline StaticLuaCallbacks_t3406648379 * get_metaFunctions_6() const { return ___metaFunctions_6; }
- inline StaticLuaCallbacks_t3406648379 ** get_address_of_metaFunctions_6() { return &___metaFunctions_6; }
- inline void set_metaFunctions_6(StaticLuaCallbacks_t3406648379 * value)
- {
- ___metaFunctions_6 = value;
- Il2CppCodeGenWriteBarrier((&___metaFunctions_6), value);
- }
- inline static int32_t get_offset_of_assemblies_7() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___assemblies_7)); }
- inline List_1_t1279540245 * get_assemblies_7() const { return ___assemblies_7; }
- inline List_1_t1279540245 ** get_address_of_assemblies_7() { return &___assemblies_7; }
- inline void set_assemblies_7(List_1_t1279540245 * value)
- {
- ___assemblies_7 = value;
- Il2CppCodeGenWriteBarrier((&___assemblies_7), value);
- }
- inline static int32_t get_offset_of_importTypeFunction_8() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___importTypeFunction_8)); }
- inline lua_CSFunction_t883524059 * get_importTypeFunction_8() const { return ___importTypeFunction_8; }
- inline lua_CSFunction_t883524059 ** get_address_of_importTypeFunction_8() { return &___importTypeFunction_8; }
- inline void set_importTypeFunction_8(lua_CSFunction_t883524059 * value)
- {
- ___importTypeFunction_8 = value;
- Il2CppCodeGenWriteBarrier((&___importTypeFunction_8), value);
- }
- inline static int32_t get_offset_of_loadAssemblyFunction_9() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___loadAssemblyFunction_9)); }
- inline lua_CSFunction_t883524059 * get_loadAssemblyFunction_9() const { return ___loadAssemblyFunction_9; }
- inline lua_CSFunction_t883524059 ** get_address_of_loadAssemblyFunction_9() { return &___loadAssemblyFunction_9; }
- inline void set_loadAssemblyFunction_9(lua_CSFunction_t883524059 * value)
- {
- ___loadAssemblyFunction_9 = value;
- Il2CppCodeGenWriteBarrier((&___loadAssemblyFunction_9), value);
- }
- inline static int32_t get_offset_of_castFunction_10() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___castFunction_10)); }
- inline lua_CSFunction_t883524059 * get_castFunction_10() const { return ___castFunction_10; }
- inline lua_CSFunction_t883524059 ** get_address_of_castFunction_10() { return &___castFunction_10; }
- inline void set_castFunction_10(lua_CSFunction_t883524059 * value)
- {
- ___castFunction_10 = value;
- Il2CppCodeGenWriteBarrier((&___castFunction_10), value);
- }
- inline static int32_t get_offset_of_delayWrap_11() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___delayWrap_11)); }
- inline Dictionary_2_t3456964840 * get_delayWrap_11() const { return ___delayWrap_11; }
- inline Dictionary_2_t3456964840 ** get_address_of_delayWrap_11() { return &___delayWrap_11; }
- inline void set_delayWrap_11(Dictionary_2_t3456964840 * value)
- {
- ___delayWrap_11 = value;
- Il2CppCodeGenWriteBarrier((&___delayWrap_11), value);
- }
- inline static int32_t get_offset_of_interfaceBridgeCreators_12() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___interfaceBridgeCreators_12)); }
- inline Dictionary_2_t1325155278 * get_interfaceBridgeCreators_12() const { return ___interfaceBridgeCreators_12; }
- inline Dictionary_2_t1325155278 ** get_address_of_interfaceBridgeCreators_12() { return &___interfaceBridgeCreators_12; }
- inline void set_interfaceBridgeCreators_12(Dictionary_2_t1325155278 * value)
- {
- ___interfaceBridgeCreators_12 = value;
- Il2CppCodeGenWriteBarrier((&___interfaceBridgeCreators_12), value);
- }
- inline static int32_t get_offset_of_aliasCfg_13() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___aliasCfg_13)); }
- inline Dictionary_2_t633324528 * get_aliasCfg_13() const { return ___aliasCfg_13; }
- inline Dictionary_2_t633324528 ** get_address_of_aliasCfg_13() { return &___aliasCfg_13; }
- inline void set_aliasCfg_13(Dictionary_2_t633324528 * value)
- {
- ___aliasCfg_13 = value;
- Il2CppCodeGenWriteBarrier((&___aliasCfg_13), value);
- }
- inline static int32_t get_offset_of_loaded_types_14() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___loaded_types_14)); }
- inline Dictionary_2_t2541635029 * get_loaded_types_14() const { return ___loaded_types_14; }
- inline Dictionary_2_t2541635029 ** get_address_of_loaded_types_14() { return &___loaded_types_14; }
- inline void set_loaded_types_14(Dictionary_2_t2541635029 * value)
- {
- ___loaded_types_14 = value;
- Il2CppCodeGenWriteBarrier((&___loaded_types_14), value);
- }
- inline static int32_t get_offset_of_cacheRef_15() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___cacheRef_15)); }
- inline int32_t get_cacheRef_15() const { return ___cacheRef_15; }
- inline int32_t* get_address_of_cacheRef_15() { return &___cacheRef_15; }
- inline void set_cacheRef_15(int32_t value)
- {
- ___cacheRef_15 = value;
- }
- inline static int32_t get_offset_of_genericAction_16() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___genericAction_16)); }
- inline MethodInfoU5BU5D_t2572182361* get_genericAction_16() const { return ___genericAction_16; }
- inline MethodInfoU5BU5D_t2572182361** get_address_of_genericAction_16() { return &___genericAction_16; }
- inline void set_genericAction_16(MethodInfoU5BU5D_t2572182361* value)
- {
- ___genericAction_16 = value;
- Il2CppCodeGenWriteBarrier((&___genericAction_16), value);
- }
- inline static int32_t get_offset_of_genericFunc_17() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___genericFunc_17)); }
- inline MethodInfoU5BU5D_t2572182361* get_genericFunc_17() const { return ___genericFunc_17; }
- inline MethodInfoU5BU5D_t2572182361** get_address_of_genericFunc_17() { return &___genericFunc_17; }
- inline void set_genericFunc_17(MethodInfoU5BU5D_t2572182361* value)
- {
- ___genericFunc_17 = value;
- Il2CppCodeGenWriteBarrier((&___genericFunc_17), value);
- }
- inline static int32_t get_offset_of_delegateCreatorCache_18() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___delegateCreatorCache_18)); }
- inline Dictionary_2_t3427006295 * get_delegateCreatorCache_18() const { return ___delegateCreatorCache_18; }
- inline Dictionary_2_t3427006295 ** get_address_of_delegateCreatorCache_18() { return &___delegateCreatorCache_18; }
- inline void set_delegateCreatorCache_18(Dictionary_2_t3427006295 * value)
- {
- ___delegateCreatorCache_18 = value;
- Il2CppCodeGenWriteBarrier((&___delegateCreatorCache_18), value);
- }
- inline static int32_t get_offset_of_delegate_bridges_19() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___delegate_bridges_19)); }
- inline Dictionary_2_t223600047 * get_delegate_bridges_19() const { return ___delegate_bridges_19; }
- inline Dictionary_2_t223600047 ** get_address_of_delegate_bridges_19() { return &___delegate_bridges_19; }
- inline void set_delegate_bridges_19(Dictionary_2_t223600047 * value)
- {
- ___delegate_bridges_19 = value;
- Il2CppCodeGenWriteBarrier((&___delegate_bridges_19), value);
- }
- inline static int32_t get_offset_of_common_array_meta_20() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___common_array_meta_20)); }
- inline int32_t get_common_array_meta_20() const { return ___common_array_meta_20; }
- inline int32_t* get_address_of_common_array_meta_20() { return &___common_array_meta_20; }
- inline void set_common_array_meta_20(int32_t value)
- {
- ___common_array_meta_20 = value;
- }
- inline static int32_t get_offset_of_common_delegate_meta_21() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___common_delegate_meta_21)); }
- inline int32_t get_common_delegate_meta_21() const { return ___common_delegate_meta_21; }
- inline int32_t* get_address_of_common_delegate_meta_21() { return &___common_delegate_meta_21; }
- inline void set_common_delegate_meta_21(int32_t value)
- {
- ___common_delegate_meta_21 = value;
- }
- inline static int32_t get_offset_of_enumerable_pairs_func_22() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___enumerable_pairs_func_22)); }
- inline int32_t get_enumerable_pairs_func_22() const { return ___enumerable_pairs_func_22; }
- inline int32_t* get_address_of_enumerable_pairs_func_22() { return &___enumerable_pairs_func_22; }
- inline void set_enumerable_pairs_func_22(int32_t value)
- {
- ___enumerable_pairs_func_22 = value;
- }
- inline static int32_t get_offset_of_typeIdMap_23() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___typeIdMap_23)); }
- inline Dictionary_2_t1100325521 * get_typeIdMap_23() const { return ___typeIdMap_23; }
- inline Dictionary_2_t1100325521 ** get_address_of_typeIdMap_23() { return &___typeIdMap_23; }
- inline void set_typeIdMap_23(Dictionary_2_t1100325521 * value)
- {
- ___typeIdMap_23 = value;
- Il2CppCodeGenWriteBarrier((&___typeIdMap_23), value);
- }
- inline static int32_t get_offset_of_typeMap_24() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___typeMap_24)); }
- inline Dictionary_2_t1372658091 * get_typeMap_24() const { return ___typeMap_24; }
- inline Dictionary_2_t1372658091 ** get_address_of_typeMap_24() { return &___typeMap_24; }
- inline void set_typeMap_24(Dictionary_2_t1372658091 * value)
- {
- ___typeMap_24 = value;
- Il2CppCodeGenWriteBarrier((&___typeMap_24), value);
- }
- inline static int32_t get_offset_of_privateAccessibleFlags_25() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___privateAccessibleFlags_25)); }
- inline HashSet_1_t1048894234 * get_privateAccessibleFlags_25() const { return ___privateAccessibleFlags_25; }
- inline HashSet_1_t1048894234 ** get_address_of_privateAccessibleFlags_25() { return &___privateAccessibleFlags_25; }
- inline void set_privateAccessibleFlags_25(HashSet_1_t1048894234 * value)
- {
- ___privateAccessibleFlags_25 = value;
- Il2CppCodeGenWriteBarrier((&___privateAccessibleFlags_25), value);
- }
- inline static int32_t get_offset_of_enumMap_26() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___enumMap_26)); }
- inline Dictionary_2_t3384741 * get_enumMap_26() const { return ___enumMap_26; }
- inline Dictionary_2_t3384741 ** get_address_of_enumMap_26() { return &___enumMap_26; }
- inline void set_enumMap_26(Dictionary_2_t3384741 * value)
- {
- ___enumMap_26 = value;
- Il2CppCodeGenWriteBarrier((&___enumMap_26), value);
- }
- inline static int32_t get_offset_of_fix_cs_functions_27() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___fix_cs_functions_27)); }
- inline List_1_t2355598801 * get_fix_cs_functions_27() const { return ___fix_cs_functions_27; }
- inline List_1_t2355598801 ** get_address_of_fix_cs_functions_27() { return &___fix_cs_functions_27; }
- inline void set_fix_cs_functions_27(List_1_t2355598801 * value)
- {
- ___fix_cs_functions_27 = value;
- Il2CppCodeGenWriteBarrier((&___fix_cs_functions_27), value);
- }
- inline static int32_t get_offset_of_custom_push_funcs_28() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___custom_push_funcs_28)); }
- inline Dictionary_2_t974727102 * get_custom_push_funcs_28() const { return ___custom_push_funcs_28; }
- inline Dictionary_2_t974727102 ** get_address_of_custom_push_funcs_28() { return &___custom_push_funcs_28; }
- inline void set_custom_push_funcs_28(Dictionary_2_t974727102 * value)
- {
- ___custom_push_funcs_28 = value;
- Il2CppCodeGenWriteBarrier((&___custom_push_funcs_28), value);
- }
- inline static int32_t get_offset_of_custom_get_funcs_29() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___custom_get_funcs_29)); }
- inline Dictionary_2_t3199299591 * get_custom_get_funcs_29() const { return ___custom_get_funcs_29; }
- inline Dictionary_2_t3199299591 ** get_address_of_custom_get_funcs_29() { return &___custom_get_funcs_29; }
- inline void set_custom_get_funcs_29(Dictionary_2_t3199299591 * value)
- {
- ___custom_get_funcs_29 = value;
- Il2CppCodeGenWriteBarrier((&___custom_get_funcs_29), value);
- }
- inline static int32_t get_offset_of_custom_update_funcs_30() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___custom_update_funcs_30)); }
- inline Dictionary_2_t2411574205 * get_custom_update_funcs_30() const { return ___custom_update_funcs_30; }
- inline Dictionary_2_t2411574205 ** get_address_of_custom_update_funcs_30() { return &___custom_update_funcs_30; }
- inline void set_custom_update_funcs_30(Dictionary_2_t2411574205 * value)
- {
- ___custom_update_funcs_30 = value;
- Il2CppCodeGenWriteBarrier((&___custom_update_funcs_30), value);
- }
- inline static int32_t get_offset_of_push_func_with_type_31() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___push_func_with_type_31)); }
- inline Dictionary_2_t3632739877 * get_push_func_with_type_31() const { return ___push_func_with_type_31; }
- inline Dictionary_2_t3632739877 ** get_address_of_push_func_with_type_31() { return &___push_func_with_type_31; }
- inline void set_push_func_with_type_31(Dictionary_2_t3632739877 * value)
- {
- ___push_func_with_type_31 = value;
- Il2CppCodeGenWriteBarrier((&___push_func_with_type_31), value);
- }
- inline static int32_t get_offset_of_get_func_with_type_32() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___get_func_with_type_32)); }
- inline Dictionary_2_t3632739877 * get_get_func_with_type_32() const { return ___get_func_with_type_32; }
- inline Dictionary_2_t3632739877 ** get_address_of_get_func_with_type_32() { return &___get_func_with_type_32; }
- inline void set_get_func_with_type_32(Dictionary_2_t3632739877 * value)
- {
- ___get_func_with_type_32 = value;
- Il2CppCodeGenWriteBarrier((&___get_func_with_type_32), value);
- }
- inline static int32_t get_offset_of_decimal_type_id_33() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___decimal_type_id_33)); }
- inline int32_t get_decimal_type_id_33() const { return ___decimal_type_id_33; }
- inline int32_t* get_address_of_decimal_type_id_33() { return &___decimal_type_id_33; }
- inline void set_decimal_type_id_33(int32_t value)
- {
- ___decimal_type_id_33 = value;
- }
- inline static int32_t get_offset_of_XLuaTestPedding_TypeID_35() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___XLuaTestPedding_TypeID_35)); }
- inline int32_t get_XLuaTestPedding_TypeID_35() const { return ___XLuaTestPedding_TypeID_35; }
- inline int32_t* get_address_of_XLuaTestPedding_TypeID_35() { return &___XLuaTestPedding_TypeID_35; }
- inline void set_XLuaTestPedding_TypeID_35(int32_t value)
- {
- ___XLuaTestPedding_TypeID_35 = value;
- }
- inline static int32_t get_offset_of_XLuaTestMyStruct_TypeID_36() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___XLuaTestMyStruct_TypeID_36)); }
- inline int32_t get_XLuaTestMyStruct_TypeID_36() const { return ___XLuaTestMyStruct_TypeID_36; }
- inline int32_t* get_address_of_XLuaTestMyStruct_TypeID_36() { return &___XLuaTestMyStruct_TypeID_36; }
- inline void set_XLuaTestMyStruct_TypeID_36(int32_t value)
- {
- ___XLuaTestMyStruct_TypeID_36 = value;
- }
- inline static int32_t get_offset_of_XLuaTestPushAsTableStruct_TypeID_37() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___XLuaTestPushAsTableStruct_TypeID_37)); }
- inline int32_t get_XLuaTestPushAsTableStruct_TypeID_37() const { return ___XLuaTestPushAsTableStruct_TypeID_37; }
- inline int32_t* get_address_of_XLuaTestPushAsTableStruct_TypeID_37() { return &___XLuaTestPushAsTableStruct_TypeID_37; }
- inline void set_XLuaTestPushAsTableStruct_TypeID_37(int32_t value)
- {
- ___XLuaTestPushAsTableStruct_TypeID_37 = value;
- }
- inline static int32_t get_offset_of_UnityEngineVector2_TypeID_38() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineVector2_TypeID_38)); }
- inline int32_t get_UnityEngineVector2_TypeID_38() const { return ___UnityEngineVector2_TypeID_38; }
- inline int32_t* get_address_of_UnityEngineVector2_TypeID_38() { return &___UnityEngineVector2_TypeID_38; }
- inline void set_UnityEngineVector2_TypeID_38(int32_t value)
- {
- ___UnityEngineVector2_TypeID_38 = value;
- }
- inline static int32_t get_offset_of_UnityEngineVector3_TypeID_39() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineVector3_TypeID_39)); }
- inline int32_t get_UnityEngineVector3_TypeID_39() const { return ___UnityEngineVector3_TypeID_39; }
- inline int32_t* get_address_of_UnityEngineVector3_TypeID_39() { return &___UnityEngineVector3_TypeID_39; }
- inline void set_UnityEngineVector3_TypeID_39(int32_t value)
- {
- ___UnityEngineVector3_TypeID_39 = value;
- }
- inline static int32_t get_offset_of_UnityEngineVector4_TypeID_40() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineVector4_TypeID_40)); }
- inline int32_t get_UnityEngineVector4_TypeID_40() const { return ___UnityEngineVector4_TypeID_40; }
- inline int32_t* get_address_of_UnityEngineVector4_TypeID_40() { return &___UnityEngineVector4_TypeID_40; }
- inline void set_UnityEngineVector4_TypeID_40(int32_t value)
- {
- ___UnityEngineVector4_TypeID_40 = value;
- }
- inline static int32_t get_offset_of_UnityEngineColor_TypeID_41() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineColor_TypeID_41)); }
- inline int32_t get_UnityEngineColor_TypeID_41() const { return ___UnityEngineColor_TypeID_41; }
- inline int32_t* get_address_of_UnityEngineColor_TypeID_41() { return &___UnityEngineColor_TypeID_41; }
- inline void set_UnityEngineColor_TypeID_41(int32_t value)
- {
- ___UnityEngineColor_TypeID_41 = value;
- }
- inline static int32_t get_offset_of_UnityEngineQuaternion_TypeID_42() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineQuaternion_TypeID_42)); }
- inline int32_t get_UnityEngineQuaternion_TypeID_42() const { return ___UnityEngineQuaternion_TypeID_42; }
- inline int32_t* get_address_of_UnityEngineQuaternion_TypeID_42() { return &___UnityEngineQuaternion_TypeID_42; }
- inline void set_UnityEngineQuaternion_TypeID_42(int32_t value)
- {
- ___UnityEngineQuaternion_TypeID_42 = value;
- }
- inline static int32_t get_offset_of_UnityEngineRay_TypeID_43() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineRay_TypeID_43)); }
- inline int32_t get_UnityEngineRay_TypeID_43() const { return ___UnityEngineRay_TypeID_43; }
- inline int32_t* get_address_of_UnityEngineRay_TypeID_43() { return &___UnityEngineRay_TypeID_43; }
- inline void set_UnityEngineRay_TypeID_43(int32_t value)
- {
- ___UnityEngineRay_TypeID_43 = value;
- }
- inline static int32_t get_offset_of_UnityEngineBounds_TypeID_44() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineBounds_TypeID_44)); }
- inline int32_t get_UnityEngineBounds_TypeID_44() const { return ___UnityEngineBounds_TypeID_44; }
- inline int32_t* get_address_of_UnityEngineBounds_TypeID_44() { return &___UnityEngineBounds_TypeID_44; }
- inline void set_UnityEngineBounds_TypeID_44(int32_t value)
- {
- ___UnityEngineBounds_TypeID_44 = value;
- }
- inline static int32_t get_offset_of_UnityEngineRay2D_TypeID_45() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___UnityEngineRay2D_TypeID_45)); }
- inline int32_t get_UnityEngineRay2D_TypeID_45() const { return ___UnityEngineRay2D_TypeID_45; }
- inline int32_t* get_address_of_UnityEngineRay2D_TypeID_45() { return &___UnityEngineRay2D_TypeID_45; }
- inline void set_UnityEngineRay2D_TypeID_45(int32_t value)
- {
- ___UnityEngineRay2D_TypeID_45 = value;
- }
- inline static int32_t get_offset_of_DGTweeningAutoPlay_TypeID_46() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningAutoPlay_TypeID_46)); }
- inline int32_t get_DGTweeningAutoPlay_TypeID_46() const { return ___DGTweeningAutoPlay_TypeID_46; }
- inline int32_t* get_address_of_DGTweeningAutoPlay_TypeID_46() { return &___DGTweeningAutoPlay_TypeID_46; }
- inline void set_DGTweeningAutoPlay_TypeID_46(int32_t value)
- {
- ___DGTweeningAutoPlay_TypeID_46 = value;
- }
- inline static int32_t get_offset_of_DGTweeningAutoPlay_EnumRef_47() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningAutoPlay_EnumRef_47)); }
- inline int32_t get_DGTweeningAutoPlay_EnumRef_47() const { return ___DGTweeningAutoPlay_EnumRef_47; }
- inline int32_t* get_address_of_DGTweeningAutoPlay_EnumRef_47() { return &___DGTweeningAutoPlay_EnumRef_47; }
- inline void set_DGTweeningAutoPlay_EnumRef_47(int32_t value)
- {
- ___DGTweeningAutoPlay_EnumRef_47 = value;
- }
- inline static int32_t get_offset_of_DGTweeningAxisConstraint_TypeID_48() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningAxisConstraint_TypeID_48)); }
- inline int32_t get_DGTweeningAxisConstraint_TypeID_48() const { return ___DGTweeningAxisConstraint_TypeID_48; }
- inline int32_t* get_address_of_DGTweeningAxisConstraint_TypeID_48() { return &___DGTweeningAxisConstraint_TypeID_48; }
- inline void set_DGTweeningAxisConstraint_TypeID_48(int32_t value)
- {
- ___DGTweeningAxisConstraint_TypeID_48 = value;
- }
- inline static int32_t get_offset_of_DGTweeningAxisConstraint_EnumRef_49() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningAxisConstraint_EnumRef_49)); }
- inline int32_t get_DGTweeningAxisConstraint_EnumRef_49() const { return ___DGTweeningAxisConstraint_EnumRef_49; }
- inline int32_t* get_address_of_DGTweeningAxisConstraint_EnumRef_49() { return &___DGTweeningAxisConstraint_EnumRef_49; }
- inline void set_DGTweeningAxisConstraint_EnumRef_49(int32_t value)
- {
- ___DGTweeningAxisConstraint_EnumRef_49 = value;
- }
- inline static int32_t get_offset_of_DGTweeningEase_TypeID_50() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningEase_TypeID_50)); }
- inline int32_t get_DGTweeningEase_TypeID_50() const { return ___DGTweeningEase_TypeID_50; }
- inline int32_t* get_address_of_DGTweeningEase_TypeID_50() { return &___DGTweeningEase_TypeID_50; }
- inline void set_DGTweeningEase_TypeID_50(int32_t value)
- {
- ___DGTweeningEase_TypeID_50 = value;
- }
- inline static int32_t get_offset_of_DGTweeningEase_EnumRef_51() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningEase_EnumRef_51)); }
- inline int32_t get_DGTweeningEase_EnumRef_51() const { return ___DGTweeningEase_EnumRef_51; }
- inline int32_t* get_address_of_DGTweeningEase_EnumRef_51() { return &___DGTweeningEase_EnumRef_51; }
- inline void set_DGTweeningEase_EnumRef_51(int32_t value)
- {
- ___DGTweeningEase_EnumRef_51 = value;
- }
- inline static int32_t get_offset_of_DGTweeningLogBehaviour_TypeID_52() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningLogBehaviour_TypeID_52)); }
- inline int32_t get_DGTweeningLogBehaviour_TypeID_52() const { return ___DGTweeningLogBehaviour_TypeID_52; }
- inline int32_t* get_address_of_DGTweeningLogBehaviour_TypeID_52() { return &___DGTweeningLogBehaviour_TypeID_52; }
- inline void set_DGTweeningLogBehaviour_TypeID_52(int32_t value)
- {
- ___DGTweeningLogBehaviour_TypeID_52 = value;
- }
- inline static int32_t get_offset_of_DGTweeningLogBehaviour_EnumRef_53() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningLogBehaviour_EnumRef_53)); }
- inline int32_t get_DGTweeningLogBehaviour_EnumRef_53() const { return ___DGTweeningLogBehaviour_EnumRef_53; }
- inline int32_t* get_address_of_DGTweeningLogBehaviour_EnumRef_53() { return &___DGTweeningLogBehaviour_EnumRef_53; }
- inline void set_DGTweeningLogBehaviour_EnumRef_53(int32_t value)
- {
- ___DGTweeningLogBehaviour_EnumRef_53 = value;
- }
- inline static int32_t get_offset_of_DGTweeningLoopType_TypeID_54() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningLoopType_TypeID_54)); }
- inline int32_t get_DGTweeningLoopType_TypeID_54() const { return ___DGTweeningLoopType_TypeID_54; }
- inline int32_t* get_address_of_DGTweeningLoopType_TypeID_54() { return &___DGTweeningLoopType_TypeID_54; }
- inline void set_DGTweeningLoopType_TypeID_54(int32_t value)
- {
- ___DGTweeningLoopType_TypeID_54 = value;
- }
- inline static int32_t get_offset_of_DGTweeningLoopType_EnumRef_55() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningLoopType_EnumRef_55)); }
- inline int32_t get_DGTweeningLoopType_EnumRef_55() const { return ___DGTweeningLoopType_EnumRef_55; }
- inline int32_t* get_address_of_DGTweeningLoopType_EnumRef_55() { return &___DGTweeningLoopType_EnumRef_55; }
- inline void set_DGTweeningLoopType_EnumRef_55(int32_t value)
- {
- ___DGTweeningLoopType_EnumRef_55 = value;
- }
- inline static int32_t get_offset_of_DGTweeningPathMode_TypeID_56() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningPathMode_TypeID_56)); }
- inline int32_t get_DGTweeningPathMode_TypeID_56() const { return ___DGTweeningPathMode_TypeID_56; }
- inline int32_t* get_address_of_DGTweeningPathMode_TypeID_56() { return &___DGTweeningPathMode_TypeID_56; }
- inline void set_DGTweeningPathMode_TypeID_56(int32_t value)
- {
- ___DGTweeningPathMode_TypeID_56 = value;
- }
- inline static int32_t get_offset_of_DGTweeningPathMode_EnumRef_57() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningPathMode_EnumRef_57)); }
- inline int32_t get_DGTweeningPathMode_EnumRef_57() const { return ___DGTweeningPathMode_EnumRef_57; }
- inline int32_t* get_address_of_DGTweeningPathMode_EnumRef_57() { return &___DGTweeningPathMode_EnumRef_57; }
- inline void set_DGTweeningPathMode_EnumRef_57(int32_t value)
- {
- ___DGTweeningPathMode_EnumRef_57 = value;
- }
- inline static int32_t get_offset_of_DGTweeningPathType_TypeID_58() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningPathType_TypeID_58)); }
- inline int32_t get_DGTweeningPathType_TypeID_58() const { return ___DGTweeningPathType_TypeID_58; }
- inline int32_t* get_address_of_DGTweeningPathType_TypeID_58() { return &___DGTweeningPathType_TypeID_58; }
- inline void set_DGTweeningPathType_TypeID_58(int32_t value)
- {
- ___DGTweeningPathType_TypeID_58 = value;
- }
- inline static int32_t get_offset_of_DGTweeningPathType_EnumRef_59() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningPathType_EnumRef_59)); }
- inline int32_t get_DGTweeningPathType_EnumRef_59() const { return ___DGTweeningPathType_EnumRef_59; }
- inline int32_t* get_address_of_DGTweeningPathType_EnumRef_59() { return &___DGTweeningPathType_EnumRef_59; }
- inline void set_DGTweeningPathType_EnumRef_59(int32_t value)
- {
- ___DGTweeningPathType_EnumRef_59 = value;
- }
- inline static int32_t get_offset_of_DGTweeningRotateMode_TypeID_60() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningRotateMode_TypeID_60)); }
- inline int32_t get_DGTweeningRotateMode_TypeID_60() const { return ___DGTweeningRotateMode_TypeID_60; }
- inline int32_t* get_address_of_DGTweeningRotateMode_TypeID_60() { return &___DGTweeningRotateMode_TypeID_60; }
- inline void set_DGTweeningRotateMode_TypeID_60(int32_t value)
- {
- ___DGTweeningRotateMode_TypeID_60 = value;
- }
- inline static int32_t get_offset_of_DGTweeningRotateMode_EnumRef_61() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningRotateMode_EnumRef_61)); }
- inline int32_t get_DGTweeningRotateMode_EnumRef_61() const { return ___DGTweeningRotateMode_EnumRef_61; }
- inline int32_t* get_address_of_DGTweeningRotateMode_EnumRef_61() { return &___DGTweeningRotateMode_EnumRef_61; }
- inline void set_DGTweeningRotateMode_EnumRef_61(int32_t value)
- {
- ___DGTweeningRotateMode_EnumRef_61 = value;
- }
- inline static int32_t get_offset_of_DGTweeningScrambleMode_TypeID_62() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningScrambleMode_TypeID_62)); }
- inline int32_t get_DGTweeningScrambleMode_TypeID_62() const { return ___DGTweeningScrambleMode_TypeID_62; }
- inline int32_t* get_address_of_DGTweeningScrambleMode_TypeID_62() { return &___DGTweeningScrambleMode_TypeID_62; }
- inline void set_DGTweeningScrambleMode_TypeID_62(int32_t value)
- {
- ___DGTweeningScrambleMode_TypeID_62 = value;
- }
- inline static int32_t get_offset_of_DGTweeningScrambleMode_EnumRef_63() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningScrambleMode_EnumRef_63)); }
- inline int32_t get_DGTweeningScrambleMode_EnumRef_63() const { return ___DGTweeningScrambleMode_EnumRef_63; }
- inline int32_t* get_address_of_DGTweeningScrambleMode_EnumRef_63() { return &___DGTweeningScrambleMode_EnumRef_63; }
- inline void set_DGTweeningScrambleMode_EnumRef_63(int32_t value)
- {
- ___DGTweeningScrambleMode_EnumRef_63 = value;
- }
- inline static int32_t get_offset_of_DGTweeningTweenType_TypeID_64() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningTweenType_TypeID_64)); }
- inline int32_t get_DGTweeningTweenType_TypeID_64() const { return ___DGTweeningTweenType_TypeID_64; }
- inline int32_t* get_address_of_DGTweeningTweenType_TypeID_64() { return &___DGTweeningTweenType_TypeID_64; }
- inline void set_DGTweeningTweenType_TypeID_64(int32_t value)
- {
- ___DGTweeningTweenType_TypeID_64 = value;
- }
- inline static int32_t get_offset_of_DGTweeningTweenType_EnumRef_65() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningTweenType_EnumRef_65)); }
- inline int32_t get_DGTweeningTweenType_EnumRef_65() const { return ___DGTweeningTweenType_EnumRef_65; }
- inline int32_t* get_address_of_DGTweeningTweenType_EnumRef_65() { return &___DGTweeningTweenType_EnumRef_65; }
- inline void set_DGTweeningTweenType_EnumRef_65(int32_t value)
- {
- ___DGTweeningTweenType_EnumRef_65 = value;
- }
- inline static int32_t get_offset_of_DGTweeningUpdateType_TypeID_66() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningUpdateType_TypeID_66)); }
- inline int32_t get_DGTweeningUpdateType_TypeID_66() const { return ___DGTweeningUpdateType_TypeID_66; }
- inline int32_t* get_address_of_DGTweeningUpdateType_TypeID_66() { return &___DGTweeningUpdateType_TypeID_66; }
- inline void set_DGTweeningUpdateType_TypeID_66(int32_t value)
- {
- ___DGTweeningUpdateType_TypeID_66 = value;
- }
- inline static int32_t get_offset_of_DGTweeningUpdateType_EnumRef_67() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___DGTweeningUpdateType_EnumRef_67)); }
- inline int32_t get_DGTweeningUpdateType_EnumRef_67() const { return ___DGTweeningUpdateType_EnumRef_67; }
- inline int32_t* get_address_of_DGTweeningUpdateType_EnumRef_67() { return &___DGTweeningUpdateType_EnumRef_67; }
- inline void set_DGTweeningUpdateType_EnumRef_67(int32_t value)
- {
- ___DGTweeningUpdateType_EnumRef_67 = value;
- }
- inline static int32_t get_offset_of_XLuaTestMyEnum_TypeID_68() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___XLuaTestMyEnum_TypeID_68)); }
- inline int32_t get_XLuaTestMyEnum_TypeID_68() const { return ___XLuaTestMyEnum_TypeID_68; }
- inline int32_t* get_address_of_XLuaTestMyEnum_TypeID_68() { return &___XLuaTestMyEnum_TypeID_68; }
- inline void set_XLuaTestMyEnum_TypeID_68(int32_t value)
- {
- ___XLuaTestMyEnum_TypeID_68 = value;
- }
- inline static int32_t get_offset_of_XLuaTestMyEnum_EnumRef_69() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555, ___XLuaTestMyEnum_EnumRef_69)); }
- inline int32_t get_XLuaTestMyEnum_EnumRef_69() const { return ___XLuaTestMyEnum_EnumRef_69; }
- inline int32_t* get_address_of_XLuaTestMyEnum_EnumRef_69() { return &___XLuaTestMyEnum_EnumRef_69; }
- inline void set_XLuaTestMyEnum_EnumRef_69(int32_t value)
- {
- ___XLuaTestMyEnum_EnumRef_69 = value;
- }
- };
- struct ObjectTranslator_t2020767555_StaticFields
- {
- public:
- // XLua.ObjectTranslator/IniterAdderXLuaTestPedding XLua.ObjectTranslator::s_IniterAdderXLuaTestPedding_dumb_obj
- IniterAdderXLuaTestPedding_t2424681114 * ___s_IniterAdderXLuaTestPedding_dumb_obj_34;
- // XLua.CSObjectWrap.XLua_Gen_Initer_Register__ XLua.ObjectTranslator::s_gen_reg_dumb_obj
- XLua_Gen_Initer_Register___t560736047 * ___s_gen_reg_dumb_obj_70;
- // System.Func`2<System.Reflection.MethodInfo,System.Boolean> XLua.ObjectTranslator::<>f__am$cache0
- Func_2_t3487522507 * ___U3CU3Ef__amU24cache0_71;
- // System.Func`2<System.Reflection.MethodInfo,System.Int32> XLua.ObjectTranslator::<>f__am$cache1
- Func_2_t2046212999 * ___U3CU3Ef__amU24cache1_72;
- // System.Func`2<System.Reflection.MethodInfo,System.Boolean> XLua.ObjectTranslator::<>f__am$cache2
- Func_2_t3487522507 * ___U3CU3Ef__amU24cache2_73;
- // System.Func`2<System.Reflection.MethodInfo,System.Int32> XLua.ObjectTranslator::<>f__am$cache3
- Func_2_t2046212999 * ___U3CU3Ef__amU24cache3_74;
- // System.Func`2<XLua.DelegateBridgeBase,System.Delegate> XLua.ObjectTranslator::<>f__am$cache4
- Func_2_t982659231 * ___U3CU3Ef__amU24cache4_75;
- // System.Func`2<XLua.DelegateBridgeBase,System.Delegate> XLua.ObjectTranslator::<>f__am$cache5
- Func_2_t982659231 * ___U3CU3Ef__amU24cache5_76;
- // System.Func`2<System.Reflection.ParameterInfo,System.Type> XLua.ObjectTranslator::<>f__am$cache6
- Func_2_t3692615456 * ___U3CU3Ef__amU24cache6_77;
- // System.Func`2<System.Reflection.MethodInfo,System.Boolean> XLua.ObjectTranslator::<>f__am$cache7
- Func_2_t3487522507 * ___U3CU3Ef__amU24cache7_78;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache0
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache0_79;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache1
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache1_80;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache2
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache2_81;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache3
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache3_82;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache4
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache4_83;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache5
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache5_84;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache6
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache6_85;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache7
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache7_86;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache8
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache8_87;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cache9
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cache9_88;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cacheA
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheA_89;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cacheB
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheB_90;
- // XLua.LuaDLL.lua_CSFunction XLua.ObjectTranslator::<>f__mg$cacheC
- lua_CSFunction_t883524059 * ___U3CU3Ef__mgU24cacheC_91;
- public:
- inline static int32_t get_offset_of_s_IniterAdderXLuaTestPedding_dumb_obj_34() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___s_IniterAdderXLuaTestPedding_dumb_obj_34)); }
- inline IniterAdderXLuaTestPedding_t2424681114 * get_s_IniterAdderXLuaTestPedding_dumb_obj_34() const { return ___s_IniterAdderXLuaTestPedding_dumb_obj_34; }
- inline IniterAdderXLuaTestPedding_t2424681114 ** get_address_of_s_IniterAdderXLuaTestPedding_dumb_obj_34() { return &___s_IniterAdderXLuaTestPedding_dumb_obj_34; }
- inline void set_s_IniterAdderXLuaTestPedding_dumb_obj_34(IniterAdderXLuaTestPedding_t2424681114 * value)
- {
- ___s_IniterAdderXLuaTestPedding_dumb_obj_34 = value;
- Il2CppCodeGenWriteBarrier((&___s_IniterAdderXLuaTestPedding_dumb_obj_34), value);
- }
- inline static int32_t get_offset_of_s_gen_reg_dumb_obj_70() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___s_gen_reg_dumb_obj_70)); }
- inline XLua_Gen_Initer_Register___t560736047 * get_s_gen_reg_dumb_obj_70() const { return ___s_gen_reg_dumb_obj_70; }
- inline XLua_Gen_Initer_Register___t560736047 ** get_address_of_s_gen_reg_dumb_obj_70() { return &___s_gen_reg_dumb_obj_70; }
- inline void set_s_gen_reg_dumb_obj_70(XLua_Gen_Initer_Register___t560736047 * value)
- {
- ___s_gen_reg_dumb_obj_70 = value;
- Il2CppCodeGenWriteBarrier((&___s_gen_reg_dumb_obj_70), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache0_71() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache0_71)); }
- inline Func_2_t3487522507 * get_U3CU3Ef__amU24cache0_71() const { return ___U3CU3Ef__amU24cache0_71; }
- inline Func_2_t3487522507 ** get_address_of_U3CU3Ef__amU24cache0_71() { return &___U3CU3Ef__amU24cache0_71; }
- inline void set_U3CU3Ef__amU24cache0_71(Func_2_t3487522507 * value)
- {
- ___U3CU3Ef__amU24cache0_71 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache0_71), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache1_72() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache1_72)); }
- inline Func_2_t2046212999 * get_U3CU3Ef__amU24cache1_72() const { return ___U3CU3Ef__amU24cache1_72; }
- inline Func_2_t2046212999 ** get_address_of_U3CU3Ef__amU24cache1_72() { return &___U3CU3Ef__amU24cache1_72; }
- inline void set_U3CU3Ef__amU24cache1_72(Func_2_t2046212999 * value)
- {
- ___U3CU3Ef__amU24cache1_72 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache1_72), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache2_73() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache2_73)); }
- inline Func_2_t3487522507 * get_U3CU3Ef__amU24cache2_73() const { return ___U3CU3Ef__amU24cache2_73; }
- inline Func_2_t3487522507 ** get_address_of_U3CU3Ef__amU24cache2_73() { return &___U3CU3Ef__amU24cache2_73; }
- inline void set_U3CU3Ef__amU24cache2_73(Func_2_t3487522507 * value)
- {
- ___U3CU3Ef__amU24cache2_73 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache2_73), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache3_74() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache3_74)); }
- inline Func_2_t2046212999 * get_U3CU3Ef__amU24cache3_74() const { return ___U3CU3Ef__amU24cache3_74; }
- inline Func_2_t2046212999 ** get_address_of_U3CU3Ef__amU24cache3_74() { return &___U3CU3Ef__amU24cache3_74; }
- inline void set_U3CU3Ef__amU24cache3_74(Func_2_t2046212999 * value)
- {
- ___U3CU3Ef__amU24cache3_74 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache3_74), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache4_75() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache4_75)); }
- inline Func_2_t982659231 * get_U3CU3Ef__amU24cache4_75() const { return ___U3CU3Ef__amU24cache4_75; }
- inline Func_2_t982659231 ** get_address_of_U3CU3Ef__amU24cache4_75() { return &___U3CU3Ef__amU24cache4_75; }
- inline void set_U3CU3Ef__amU24cache4_75(Func_2_t982659231 * value)
- {
- ___U3CU3Ef__amU24cache4_75 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache4_75), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache5_76() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache5_76)); }
- inline Func_2_t982659231 * get_U3CU3Ef__amU24cache5_76() const { return ___U3CU3Ef__amU24cache5_76; }
- inline Func_2_t982659231 ** get_address_of_U3CU3Ef__amU24cache5_76() { return &___U3CU3Ef__amU24cache5_76; }
- inline void set_U3CU3Ef__amU24cache5_76(Func_2_t982659231 * value)
- {
- ___U3CU3Ef__amU24cache5_76 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache5_76), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache6_77() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache6_77)); }
- inline Func_2_t3692615456 * get_U3CU3Ef__amU24cache6_77() const { return ___U3CU3Ef__amU24cache6_77; }
- inline Func_2_t3692615456 ** get_address_of_U3CU3Ef__amU24cache6_77() { return &___U3CU3Ef__amU24cache6_77; }
- inline void set_U3CU3Ef__amU24cache6_77(Func_2_t3692615456 * value)
- {
- ___U3CU3Ef__amU24cache6_77 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache6_77), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__amU24cache7_78() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__amU24cache7_78)); }
- inline Func_2_t3487522507 * get_U3CU3Ef__amU24cache7_78() const { return ___U3CU3Ef__amU24cache7_78; }
- inline Func_2_t3487522507 ** get_address_of_U3CU3Ef__amU24cache7_78() { return &___U3CU3Ef__amU24cache7_78; }
- inline void set_U3CU3Ef__amU24cache7_78(Func_2_t3487522507 * value)
- {
- ___U3CU3Ef__amU24cache7_78 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__amU24cache7_78), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache0_79() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache0_79)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache0_79() const { return ___U3CU3Ef__mgU24cache0_79; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache0_79() { return &___U3CU3Ef__mgU24cache0_79; }
- inline void set_U3CU3Ef__mgU24cache0_79(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache0_79 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache0_79), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache1_80() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache1_80)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache1_80() const { return ___U3CU3Ef__mgU24cache1_80; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache1_80() { return &___U3CU3Ef__mgU24cache1_80; }
- inline void set_U3CU3Ef__mgU24cache1_80(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache1_80 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache1_80), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache2_81() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache2_81)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache2_81() const { return ___U3CU3Ef__mgU24cache2_81; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache2_81() { return &___U3CU3Ef__mgU24cache2_81; }
- inline void set_U3CU3Ef__mgU24cache2_81(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache2_81 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache2_81), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache3_82() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache3_82)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache3_82() const { return ___U3CU3Ef__mgU24cache3_82; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache3_82() { return &___U3CU3Ef__mgU24cache3_82; }
- inline void set_U3CU3Ef__mgU24cache3_82(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache3_82 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache3_82), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache4_83() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache4_83)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache4_83() const { return ___U3CU3Ef__mgU24cache4_83; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache4_83() { return &___U3CU3Ef__mgU24cache4_83; }
- inline void set_U3CU3Ef__mgU24cache4_83(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache4_83 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache4_83), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache5_84() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache5_84)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache5_84() const { return ___U3CU3Ef__mgU24cache5_84; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache5_84() { return &___U3CU3Ef__mgU24cache5_84; }
- inline void set_U3CU3Ef__mgU24cache5_84(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache5_84 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache5_84), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache6_85() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache6_85)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache6_85() const { return ___U3CU3Ef__mgU24cache6_85; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache6_85() { return &___U3CU3Ef__mgU24cache6_85; }
- inline void set_U3CU3Ef__mgU24cache6_85(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache6_85 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache6_85), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache7_86() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache7_86)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache7_86() const { return ___U3CU3Ef__mgU24cache7_86; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache7_86() { return &___U3CU3Ef__mgU24cache7_86; }
- inline void set_U3CU3Ef__mgU24cache7_86(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache7_86 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache7_86), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache8_87() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache8_87)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache8_87() const { return ___U3CU3Ef__mgU24cache8_87; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache8_87() { return &___U3CU3Ef__mgU24cache8_87; }
- inline void set_U3CU3Ef__mgU24cache8_87(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache8_87 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache8_87), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cache9_88() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cache9_88)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cache9_88() const { return ___U3CU3Ef__mgU24cache9_88; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cache9_88() { return &___U3CU3Ef__mgU24cache9_88; }
- inline void set_U3CU3Ef__mgU24cache9_88(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cache9_88 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cache9_88), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheA_89() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cacheA_89)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheA_89() const { return ___U3CU3Ef__mgU24cacheA_89; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheA_89() { return &___U3CU3Ef__mgU24cacheA_89; }
- inline void set_U3CU3Ef__mgU24cacheA_89(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheA_89 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheA_89), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheB_90() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cacheB_90)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheB_90() const { return ___U3CU3Ef__mgU24cacheB_90; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheB_90() { return &___U3CU3Ef__mgU24cacheB_90; }
- inline void set_U3CU3Ef__mgU24cacheB_90(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheB_90 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheB_90), value);
- }
- inline static int32_t get_offset_of_U3CU3Ef__mgU24cacheC_91() { return static_cast<int32_t>(offsetof(ObjectTranslator_t2020767555_StaticFields, ___U3CU3Ef__mgU24cacheC_91)); }
- inline lua_CSFunction_t883524059 * get_U3CU3Ef__mgU24cacheC_91() const { return ___U3CU3Ef__mgU24cacheC_91; }
- inline lua_CSFunction_t883524059 ** get_address_of_U3CU3Ef__mgU24cacheC_91() { return &___U3CU3Ef__mgU24cacheC_91; }
- inline void set_U3CU3Ef__mgU24cacheC_91(lua_CSFunction_t883524059 * value)
- {
- ___U3CU3Ef__mgU24cacheC_91 = value;
- Il2CppCodeGenWriteBarrier((&___U3CU3Ef__mgU24cacheC_91), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // OBJECTTRANSLATOR_T2020767555_H
- #ifndef STRING_T_H
- #define STRING_T_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.String
- struct String_t : public RuntimeObject
- {
- public:
- // System.Int32 System.String::length
- int32_t ___length_0;
- // System.Char System.String::start_char
- Il2CppChar ___start_char_1;
- public:
- inline static int32_t get_offset_of_length_0() { return static_cast<int32_t>(offsetof(String_t, ___length_0)); }
- inline int32_t get_length_0() const { return ___length_0; }
- inline int32_t* get_address_of_length_0() { return &___length_0; }
- inline void set_length_0(int32_t value)
- {
- ___length_0 = value;
- }
- inline static int32_t get_offset_of_start_char_1() { return static_cast<int32_t>(offsetof(String_t, ___start_char_1)); }
- inline Il2CppChar get_start_char_1() const { return ___start_char_1; }
- inline Il2CppChar* get_address_of_start_char_1() { return &___start_char_1; }
- inline void set_start_char_1(Il2CppChar value)
- {
- ___start_char_1 = value;
- }
- };
- struct String_t_StaticFields
- {
- public:
- // System.String System.String::Empty
- String_t* ___Empty_2;
- // System.Char[] System.String::WhiteChars
- CharU5BU5D_t3528271667* ___WhiteChars_3;
- public:
- inline static int32_t get_offset_of_Empty_2() { return static_cast<int32_t>(offsetof(String_t_StaticFields, ___Empty_2)); }
- inline String_t* get_Empty_2() const { return ___Empty_2; }
- inline String_t** get_address_of_Empty_2() { return &___Empty_2; }
- inline void set_Empty_2(String_t* value)
- {
- ___Empty_2 = value;
- Il2CppCodeGenWriteBarrier((&___Empty_2), value);
- }
- inline static int32_t get_offset_of_WhiteChars_3() { return static_cast<int32_t>(offsetof(String_t_StaticFields, ___WhiteChars_3)); }
- inline CharU5BU5D_t3528271667* get_WhiteChars_3() const { return ___WhiteChars_3; }
- inline CharU5BU5D_t3528271667** get_address_of_WhiteChars_3() { return &___WhiteChars_3; }
- inline void set_WhiteChars_3(CharU5BU5D_t3528271667* value)
- {
- ___WhiteChars_3 = value;
- Il2CppCodeGenWriteBarrier((&___WhiteChars_3), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // STRING_T_H
- #ifndef BOOLEAN_T97287965_H
- #define BOOLEAN_T97287965_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Boolean
- struct Boolean_t97287965
- {
- public:
- // System.Boolean System.Boolean::m_value
- bool ___m_value_2;
- public:
- inline static int32_t get_offset_of_m_value_2() { return static_cast<int32_t>(offsetof(Boolean_t97287965, ___m_value_2)); }
- inline bool get_m_value_2() const { return ___m_value_2; }
- inline bool* get_address_of_m_value_2() { return &___m_value_2; }
- inline void set_m_value_2(bool value)
- {
- ___m_value_2 = value;
- }
- };
- struct Boolean_t97287965_StaticFields
- {
- public:
- // System.String System.Boolean::FalseString
- String_t* ___FalseString_0;
- // System.String System.Boolean::TrueString
- String_t* ___TrueString_1;
- public:
- inline static int32_t get_offset_of_FalseString_0() { return static_cast<int32_t>(offsetof(Boolean_t97287965_StaticFields, ___FalseString_0)); }
- inline String_t* get_FalseString_0() const { return ___FalseString_0; }
- inline String_t** get_address_of_FalseString_0() { return &___FalseString_0; }
- inline void set_FalseString_0(String_t* value)
- {
- ___FalseString_0 = value;
- Il2CppCodeGenWriteBarrier((&___FalseString_0), value);
- }
- inline static int32_t get_offset_of_TrueString_1() { return static_cast<int32_t>(offsetof(Boolean_t97287965_StaticFields, ___TrueString_1)); }
- inline String_t* get_TrueString_1() const { return ___TrueString_1; }
- inline String_t** get_address_of_TrueString_1() { return &___TrueString_1; }
- inline void set_TrueString_1(String_t* value)
- {
- ___TrueString_1 = value;
- Il2CppCodeGenWriteBarrier((&___TrueString_1), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // BOOLEAN_T97287965_H
- #ifndef VECTOR2_T2156229523_H
- #define VECTOR2_T2156229523_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Vector2
- struct Vector2_t2156229523
- {
- public:
- // System.Single UnityEngine.Vector2::x
- float ___x_0;
- // System.Single UnityEngine.Vector2::y
- float ___y_1;
- public:
- inline static int32_t get_offset_of_x_0() { return static_cast<int32_t>(offsetof(Vector2_t2156229523, ___x_0)); }
- inline float get_x_0() const { return ___x_0; }
- inline float* get_address_of_x_0() { return &___x_0; }
- inline void set_x_0(float value)
- {
- ___x_0 = value;
- }
- inline static int32_t get_offset_of_y_1() { return static_cast<int32_t>(offsetof(Vector2_t2156229523, ___y_1)); }
- inline float get_y_1() const { return ___y_1; }
- inline float* get_address_of_y_1() { return &___y_1; }
- inline void set_y_1(float value)
- {
- ___y_1 = value;
- }
- };
- struct Vector2_t2156229523_StaticFields
- {
- public:
- // UnityEngine.Vector2 UnityEngine.Vector2::zeroVector
- Vector2_t2156229523 ___zeroVector_2;
- // UnityEngine.Vector2 UnityEngine.Vector2::oneVector
- Vector2_t2156229523 ___oneVector_3;
- // UnityEngine.Vector2 UnityEngine.Vector2::upVector
- Vector2_t2156229523 ___upVector_4;
- // UnityEngine.Vector2 UnityEngine.Vector2::downVector
- Vector2_t2156229523 ___downVector_5;
- // UnityEngine.Vector2 UnityEngine.Vector2::leftVector
- Vector2_t2156229523 ___leftVector_6;
- // UnityEngine.Vector2 UnityEngine.Vector2::rightVector
- Vector2_t2156229523 ___rightVector_7;
- // UnityEngine.Vector2 UnityEngine.Vector2::positiveInfinityVector
- Vector2_t2156229523 ___positiveInfinityVector_8;
- // UnityEngine.Vector2 UnityEngine.Vector2::negativeInfinityVector
- Vector2_t2156229523 ___negativeInfinityVector_9;
- public:
- inline static int32_t get_offset_of_zeroVector_2() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___zeroVector_2)); }
- inline Vector2_t2156229523 get_zeroVector_2() const { return ___zeroVector_2; }
- inline Vector2_t2156229523 * get_address_of_zeroVector_2() { return &___zeroVector_2; }
- inline void set_zeroVector_2(Vector2_t2156229523 value)
- {
- ___zeroVector_2 = value;
- }
- inline static int32_t get_offset_of_oneVector_3() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___oneVector_3)); }
- inline Vector2_t2156229523 get_oneVector_3() const { return ___oneVector_3; }
- inline Vector2_t2156229523 * get_address_of_oneVector_3() { return &___oneVector_3; }
- inline void set_oneVector_3(Vector2_t2156229523 value)
- {
- ___oneVector_3 = value;
- }
- inline static int32_t get_offset_of_upVector_4() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___upVector_4)); }
- inline Vector2_t2156229523 get_upVector_4() const { return ___upVector_4; }
- inline Vector2_t2156229523 * get_address_of_upVector_4() { return &___upVector_4; }
- inline void set_upVector_4(Vector2_t2156229523 value)
- {
- ___upVector_4 = value;
- }
- inline static int32_t get_offset_of_downVector_5() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___downVector_5)); }
- inline Vector2_t2156229523 get_downVector_5() const { return ___downVector_5; }
- inline Vector2_t2156229523 * get_address_of_downVector_5() { return &___downVector_5; }
- inline void set_downVector_5(Vector2_t2156229523 value)
- {
- ___downVector_5 = value;
- }
- inline static int32_t get_offset_of_leftVector_6() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___leftVector_6)); }
- inline Vector2_t2156229523 get_leftVector_6() const { return ___leftVector_6; }
- inline Vector2_t2156229523 * get_address_of_leftVector_6() { return &___leftVector_6; }
- inline void set_leftVector_6(Vector2_t2156229523 value)
- {
- ___leftVector_6 = value;
- }
- inline static int32_t get_offset_of_rightVector_7() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___rightVector_7)); }
- inline Vector2_t2156229523 get_rightVector_7() const { return ___rightVector_7; }
- inline Vector2_t2156229523 * get_address_of_rightVector_7() { return &___rightVector_7; }
- inline void set_rightVector_7(Vector2_t2156229523 value)
- {
- ___rightVector_7 = value;
- }
- inline static int32_t get_offset_of_positiveInfinityVector_8() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___positiveInfinityVector_8)); }
- inline Vector2_t2156229523 get_positiveInfinityVector_8() const { return ___positiveInfinityVector_8; }
- inline Vector2_t2156229523 * get_address_of_positiveInfinityVector_8() { return &___positiveInfinityVector_8; }
- inline void set_positiveInfinityVector_8(Vector2_t2156229523 value)
- {
- ___positiveInfinityVector_8 = value;
- }
- inline static int32_t get_offset_of_negativeInfinityVector_9() { return static_cast<int32_t>(offsetof(Vector2_t2156229523_StaticFields, ___negativeInfinityVector_9)); }
- inline Vector2_t2156229523 get_negativeInfinityVector_9() const { return ___negativeInfinityVector_9; }
- inline Vector2_t2156229523 * get_address_of_negativeInfinityVector_9() { return &___negativeInfinityVector_9; }
- inline void set_negativeInfinityVector_9(Vector2_t2156229523 value)
- {
- ___negativeInfinityVector_9 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // VECTOR2_T2156229523_H
- #ifndef BYTE_T1134296376_H
- #define BYTE_T1134296376_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Byte
- struct Byte_t1134296376
- {
- public:
- // System.Byte System.Byte::m_value
- uint8_t ___m_value_2;
- public:
- inline static int32_t get_offset_of_m_value_2() { return static_cast<int32_t>(offsetof(Byte_t1134296376, ___m_value_2)); }
- inline uint8_t get_m_value_2() const { return ___m_value_2; }
- inline uint8_t* get_address_of_m_value_2() { return &___m_value_2; }
- inline void set_m_value_2(uint8_t value)
- {
- ___m_value_2 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // BYTE_T1134296376_H
- #ifndef VOID_T1185182177_H
- #define VOID_T1185182177_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Void
- struct Void_t1185182177
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // VOID_T1185182177_H
- #ifndef INTPTR_T_H
- #define INTPTR_T_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.IntPtr
- struct IntPtr_t
- {
- public:
- // System.Void* System.IntPtr::m_value
- void* ___m_value_0;
- public:
- inline static int32_t get_offset_of_m_value_0() { return static_cast<int32_t>(offsetof(IntPtr_t, ___m_value_0)); }
- inline void* get_m_value_0() const { return ___m_value_0; }
- inline void** get_address_of_m_value_0() { return &___m_value_0; }
- inline void set_m_value_0(void* value)
- {
- ___m_value_0 = value;
- }
- };
- struct IntPtr_t_StaticFields
- {
- public:
- // System.IntPtr System.IntPtr::Zero
- intptr_t ___Zero_1;
- public:
- inline static int32_t get_offset_of_Zero_1() { return static_cast<int32_t>(offsetof(IntPtr_t_StaticFields, ___Zero_1)); }
- inline intptr_t get_Zero_1() const { return ___Zero_1; }
- inline intptr_t* get_address_of_Zero_1() { return &___Zero_1; }
- inline void set_Zero_1(intptr_t value)
- {
- ___Zero_1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // INTPTR_T_H
- #ifndef VECTOR3_T3722313464_H
- #define VECTOR3_T3722313464_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Vector3
- struct Vector3_t3722313464
- {
- public:
- // System.Single UnityEngine.Vector3::x
- float ___x_1;
- // System.Single UnityEngine.Vector3::y
- float ___y_2;
- // System.Single UnityEngine.Vector3::z
- float ___z_3;
- public:
- inline static int32_t get_offset_of_x_1() { return static_cast<int32_t>(offsetof(Vector3_t3722313464, ___x_1)); }
- inline float get_x_1() const { return ___x_1; }
- inline float* get_address_of_x_1() { return &___x_1; }
- inline void set_x_1(float value)
- {
- ___x_1 = value;
- }
- inline static int32_t get_offset_of_y_2() { return static_cast<int32_t>(offsetof(Vector3_t3722313464, ___y_2)); }
- inline float get_y_2() const { return ___y_2; }
- inline float* get_address_of_y_2() { return &___y_2; }
- inline void set_y_2(float value)
- {
- ___y_2 = value;
- }
- inline static int32_t get_offset_of_z_3() { return static_cast<int32_t>(offsetof(Vector3_t3722313464, ___z_3)); }
- inline float get_z_3() const { return ___z_3; }
- inline float* get_address_of_z_3() { return &___z_3; }
- inline void set_z_3(float value)
- {
- ___z_3 = value;
- }
- };
- struct Vector3_t3722313464_StaticFields
- {
- public:
- // UnityEngine.Vector3 UnityEngine.Vector3::zeroVector
- Vector3_t3722313464 ___zeroVector_4;
- // UnityEngine.Vector3 UnityEngine.Vector3::oneVector
- Vector3_t3722313464 ___oneVector_5;
- // UnityEngine.Vector3 UnityEngine.Vector3::upVector
- Vector3_t3722313464 ___upVector_6;
- // UnityEngine.Vector3 UnityEngine.Vector3::downVector
- Vector3_t3722313464 ___downVector_7;
- // UnityEngine.Vector3 UnityEngine.Vector3::leftVector
- Vector3_t3722313464 ___leftVector_8;
- // UnityEngine.Vector3 UnityEngine.Vector3::rightVector
- Vector3_t3722313464 ___rightVector_9;
- // UnityEngine.Vector3 UnityEngine.Vector3::forwardVector
- Vector3_t3722313464 ___forwardVector_10;
- // UnityEngine.Vector3 UnityEngine.Vector3::backVector
- Vector3_t3722313464 ___backVector_11;
- // UnityEngine.Vector3 UnityEngine.Vector3::positiveInfinityVector
- Vector3_t3722313464 ___positiveInfinityVector_12;
- // UnityEngine.Vector3 UnityEngine.Vector3::negativeInfinityVector
- Vector3_t3722313464 ___negativeInfinityVector_13;
- public:
- inline static int32_t get_offset_of_zeroVector_4() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___zeroVector_4)); }
- inline Vector3_t3722313464 get_zeroVector_4() const { return ___zeroVector_4; }
- inline Vector3_t3722313464 * get_address_of_zeroVector_4() { return &___zeroVector_4; }
- inline void set_zeroVector_4(Vector3_t3722313464 value)
- {
- ___zeroVector_4 = value;
- }
- inline static int32_t get_offset_of_oneVector_5() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___oneVector_5)); }
- inline Vector3_t3722313464 get_oneVector_5() const { return ___oneVector_5; }
- inline Vector3_t3722313464 * get_address_of_oneVector_5() { return &___oneVector_5; }
- inline void set_oneVector_5(Vector3_t3722313464 value)
- {
- ___oneVector_5 = value;
- }
- inline static int32_t get_offset_of_upVector_6() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___upVector_6)); }
- inline Vector3_t3722313464 get_upVector_6() const { return ___upVector_6; }
- inline Vector3_t3722313464 * get_address_of_upVector_6() { return &___upVector_6; }
- inline void set_upVector_6(Vector3_t3722313464 value)
- {
- ___upVector_6 = value;
- }
- inline static int32_t get_offset_of_downVector_7() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___downVector_7)); }
- inline Vector3_t3722313464 get_downVector_7() const { return ___downVector_7; }
- inline Vector3_t3722313464 * get_address_of_downVector_7() { return &___downVector_7; }
- inline void set_downVector_7(Vector3_t3722313464 value)
- {
- ___downVector_7 = value;
- }
- inline static int32_t get_offset_of_leftVector_8() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___leftVector_8)); }
- inline Vector3_t3722313464 get_leftVector_8() const { return ___leftVector_8; }
- inline Vector3_t3722313464 * get_address_of_leftVector_8() { return &___leftVector_8; }
- inline void set_leftVector_8(Vector3_t3722313464 value)
- {
- ___leftVector_8 = value;
- }
- inline static int32_t get_offset_of_rightVector_9() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___rightVector_9)); }
- inline Vector3_t3722313464 get_rightVector_9() const { return ___rightVector_9; }
- inline Vector3_t3722313464 * get_address_of_rightVector_9() { return &___rightVector_9; }
- inline void set_rightVector_9(Vector3_t3722313464 value)
- {
- ___rightVector_9 = value;
- }
- inline static int32_t get_offset_of_forwardVector_10() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___forwardVector_10)); }
- inline Vector3_t3722313464 get_forwardVector_10() const { return ___forwardVector_10; }
- inline Vector3_t3722313464 * get_address_of_forwardVector_10() { return &___forwardVector_10; }
- inline void set_forwardVector_10(Vector3_t3722313464 value)
- {
- ___forwardVector_10 = value;
- }
- inline static int32_t get_offset_of_backVector_11() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___backVector_11)); }
- inline Vector3_t3722313464 get_backVector_11() const { return ___backVector_11; }
- inline Vector3_t3722313464 * get_address_of_backVector_11() { return &___backVector_11; }
- inline void set_backVector_11(Vector3_t3722313464 value)
- {
- ___backVector_11 = value;
- }
- inline static int32_t get_offset_of_positiveInfinityVector_12() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___positiveInfinityVector_12)); }
- inline Vector3_t3722313464 get_positiveInfinityVector_12() const { return ___positiveInfinityVector_12; }
- inline Vector3_t3722313464 * get_address_of_positiveInfinityVector_12() { return &___positiveInfinityVector_12; }
- inline void set_positiveInfinityVector_12(Vector3_t3722313464 value)
- {
- ___positiveInfinityVector_12 = value;
- }
- inline static int32_t get_offset_of_negativeInfinityVector_13() { return static_cast<int32_t>(offsetof(Vector3_t3722313464_StaticFields, ___negativeInfinityVector_13)); }
- inline Vector3_t3722313464 get_negativeInfinityVector_13() const { return ___negativeInfinityVector_13; }
- inline Vector3_t3722313464 * get_address_of_negativeInfinityVector_13() { return &___negativeInfinityVector_13; }
- inline void set_negativeInfinityVector_13(Vector3_t3722313464 value)
- {
- ___negativeInfinityVector_13 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // VECTOR3_T3722313464_H
- #ifndef QUATERNION_T2301928331_H
- #define QUATERNION_T2301928331_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Quaternion
- struct Quaternion_t2301928331
- {
- public:
- // System.Single UnityEngine.Quaternion::x
- float ___x_0;
- // System.Single UnityEngine.Quaternion::y
- float ___y_1;
- // System.Single UnityEngine.Quaternion::z
- float ___z_2;
- // System.Single UnityEngine.Quaternion::w
- float ___w_3;
- public:
- inline static int32_t get_offset_of_x_0() { return static_cast<int32_t>(offsetof(Quaternion_t2301928331, ___x_0)); }
- inline float get_x_0() const { return ___x_0; }
- inline float* get_address_of_x_0() { return &___x_0; }
- inline void set_x_0(float value)
- {
- ___x_0 = value;
- }
- inline static int32_t get_offset_of_y_1() { return static_cast<int32_t>(offsetof(Quaternion_t2301928331, ___y_1)); }
- inline float get_y_1() const { return ___y_1; }
- inline float* get_address_of_y_1() { return &___y_1; }
- inline void set_y_1(float value)
- {
- ___y_1 = value;
- }
- inline static int32_t get_offset_of_z_2() { return static_cast<int32_t>(offsetof(Quaternion_t2301928331, ___z_2)); }
- inline float get_z_2() const { return ___z_2; }
- inline float* get_address_of_z_2() { return &___z_2; }
- inline void set_z_2(float value)
- {
- ___z_2 = value;
- }
- inline static int32_t get_offset_of_w_3() { return static_cast<int32_t>(offsetof(Quaternion_t2301928331, ___w_3)); }
- inline float get_w_3() const { return ___w_3; }
- inline float* get_address_of_w_3() { return &___w_3; }
- inline void set_w_3(float value)
- {
- ___w_3 = value;
- }
- };
- struct Quaternion_t2301928331_StaticFields
- {
- public:
- // UnityEngine.Quaternion UnityEngine.Quaternion::identityQuaternion
- Quaternion_t2301928331 ___identityQuaternion_4;
- public:
- inline static int32_t get_offset_of_identityQuaternion_4() { return static_cast<int32_t>(offsetof(Quaternion_t2301928331_StaticFields, ___identityQuaternion_4)); }
- inline Quaternion_t2301928331 get_identityQuaternion_4() const { return ___identityQuaternion_4; }
- inline Quaternion_t2301928331 * get_address_of_identityQuaternion_4() { return &___identityQuaternion_4; }
- inline void set_identityQuaternion_4(Quaternion_t2301928331 value)
- {
- ___identityQuaternion_4 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // QUATERNION_T2301928331_H
- #ifndef INT32_T2950945753_H
- #define INT32_T2950945753_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Int32
- struct Int32_t2950945753
- {
- public:
- // System.Int32 System.Int32::m_value
- int32_t ___m_value_2;
- public:
- inline static int32_t get_offset_of_m_value_2() { return static_cast<int32_t>(offsetof(Int32_t2950945753, ___m_value_2)); }
- inline int32_t get_m_value_2() const { return ___m_value_2; }
- inline int32_t* get_address_of_m_value_2() { return &___m_value_2; }
- inline void set_m_value_2(int32_t value)
- {
- ___m_value_2 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // INT32_T2950945753_H
- #ifndef MATRIX4X4_T1817901843_H
- #define MATRIX4X4_T1817901843_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Matrix4x4
- struct Matrix4x4_t1817901843
- {
- public:
- // System.Single UnityEngine.Matrix4x4::m00
- float ___m00_0;
- // System.Single UnityEngine.Matrix4x4::m10
- float ___m10_1;
- // System.Single UnityEngine.Matrix4x4::m20
- float ___m20_2;
- // System.Single UnityEngine.Matrix4x4::m30
- float ___m30_3;
- // System.Single UnityEngine.Matrix4x4::m01
- float ___m01_4;
- // System.Single UnityEngine.Matrix4x4::m11
- float ___m11_5;
- // System.Single UnityEngine.Matrix4x4::m21
- float ___m21_6;
- // System.Single UnityEngine.Matrix4x4::m31
- float ___m31_7;
- // System.Single UnityEngine.Matrix4x4::m02
- float ___m02_8;
- // System.Single UnityEngine.Matrix4x4::m12
- float ___m12_9;
- // System.Single UnityEngine.Matrix4x4::m22
- float ___m22_10;
- // System.Single UnityEngine.Matrix4x4::m32
- float ___m32_11;
- // System.Single UnityEngine.Matrix4x4::m03
- float ___m03_12;
- // System.Single UnityEngine.Matrix4x4::m13
- float ___m13_13;
- // System.Single UnityEngine.Matrix4x4::m23
- float ___m23_14;
- // System.Single UnityEngine.Matrix4x4::m33
- float ___m33_15;
- public:
- inline static int32_t get_offset_of_m00_0() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m00_0)); }
- inline float get_m00_0() const { return ___m00_0; }
- inline float* get_address_of_m00_0() { return &___m00_0; }
- inline void set_m00_0(float value)
- {
- ___m00_0 = value;
- }
- inline static int32_t get_offset_of_m10_1() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m10_1)); }
- inline float get_m10_1() const { return ___m10_1; }
- inline float* get_address_of_m10_1() { return &___m10_1; }
- inline void set_m10_1(float value)
- {
- ___m10_1 = value;
- }
- inline static int32_t get_offset_of_m20_2() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m20_2)); }
- inline float get_m20_2() const { return ___m20_2; }
- inline float* get_address_of_m20_2() { return &___m20_2; }
- inline void set_m20_2(float value)
- {
- ___m20_2 = value;
- }
- inline static int32_t get_offset_of_m30_3() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m30_3)); }
- inline float get_m30_3() const { return ___m30_3; }
- inline float* get_address_of_m30_3() { return &___m30_3; }
- inline void set_m30_3(float value)
- {
- ___m30_3 = value;
- }
- inline static int32_t get_offset_of_m01_4() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m01_4)); }
- inline float get_m01_4() const { return ___m01_4; }
- inline float* get_address_of_m01_4() { return &___m01_4; }
- inline void set_m01_4(float value)
- {
- ___m01_4 = value;
- }
- inline static int32_t get_offset_of_m11_5() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m11_5)); }
- inline float get_m11_5() const { return ___m11_5; }
- inline float* get_address_of_m11_5() { return &___m11_5; }
- inline void set_m11_5(float value)
- {
- ___m11_5 = value;
- }
- inline static int32_t get_offset_of_m21_6() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m21_6)); }
- inline float get_m21_6() const { return ___m21_6; }
- inline float* get_address_of_m21_6() { return &___m21_6; }
- inline void set_m21_6(float value)
- {
- ___m21_6 = value;
- }
- inline static int32_t get_offset_of_m31_7() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m31_7)); }
- inline float get_m31_7() const { return ___m31_7; }
- inline float* get_address_of_m31_7() { return &___m31_7; }
- inline void set_m31_7(float value)
- {
- ___m31_7 = value;
- }
- inline static int32_t get_offset_of_m02_8() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m02_8)); }
- inline float get_m02_8() const { return ___m02_8; }
- inline float* get_address_of_m02_8() { return &___m02_8; }
- inline void set_m02_8(float value)
- {
- ___m02_8 = value;
- }
- inline static int32_t get_offset_of_m12_9() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m12_9)); }
- inline float get_m12_9() const { return ___m12_9; }
- inline float* get_address_of_m12_9() { return &___m12_9; }
- inline void set_m12_9(float value)
- {
- ___m12_9 = value;
- }
- inline static int32_t get_offset_of_m22_10() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m22_10)); }
- inline float get_m22_10() const { return ___m22_10; }
- inline float* get_address_of_m22_10() { return &___m22_10; }
- inline void set_m22_10(float value)
- {
- ___m22_10 = value;
- }
- inline static int32_t get_offset_of_m32_11() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m32_11)); }
- inline float get_m32_11() const { return ___m32_11; }
- inline float* get_address_of_m32_11() { return &___m32_11; }
- inline void set_m32_11(float value)
- {
- ___m32_11 = value;
- }
- inline static int32_t get_offset_of_m03_12() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m03_12)); }
- inline float get_m03_12() const { return ___m03_12; }
- inline float* get_address_of_m03_12() { return &___m03_12; }
- inline void set_m03_12(float value)
- {
- ___m03_12 = value;
- }
- inline static int32_t get_offset_of_m13_13() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m13_13)); }
- inline float get_m13_13() const { return ___m13_13; }
- inline float* get_address_of_m13_13() { return &___m13_13; }
- inline void set_m13_13(float value)
- {
- ___m13_13 = value;
- }
- inline static int32_t get_offset_of_m23_14() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m23_14)); }
- inline float get_m23_14() const { return ___m23_14; }
- inline float* get_address_of_m23_14() { return &___m23_14; }
- inline void set_m23_14(float value)
- {
- ___m23_14 = value;
- }
- inline static int32_t get_offset_of_m33_15() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843, ___m33_15)); }
- inline float get_m33_15() const { return ___m33_15; }
- inline float* get_address_of_m33_15() { return &___m33_15; }
- inline void set_m33_15(float value)
- {
- ___m33_15 = value;
- }
- };
- struct Matrix4x4_t1817901843_StaticFields
- {
- public:
- // UnityEngine.Matrix4x4 UnityEngine.Matrix4x4::zeroMatrix
- Matrix4x4_t1817901843 ___zeroMatrix_16;
- // UnityEngine.Matrix4x4 UnityEngine.Matrix4x4::identityMatrix
- Matrix4x4_t1817901843 ___identityMatrix_17;
- public:
- inline static int32_t get_offset_of_zeroMatrix_16() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843_StaticFields, ___zeroMatrix_16)); }
- inline Matrix4x4_t1817901843 get_zeroMatrix_16() const { return ___zeroMatrix_16; }
- inline Matrix4x4_t1817901843 * get_address_of_zeroMatrix_16() { return &___zeroMatrix_16; }
- inline void set_zeroMatrix_16(Matrix4x4_t1817901843 value)
- {
- ___zeroMatrix_16 = value;
- }
- inline static int32_t get_offset_of_identityMatrix_17() { return static_cast<int32_t>(offsetof(Matrix4x4_t1817901843_StaticFields, ___identityMatrix_17)); }
- inline Matrix4x4_t1817901843 get_identityMatrix_17() const { return ___identityMatrix_17; }
- inline Matrix4x4_t1817901843 * get_address_of_identityMatrix_17() { return &___identityMatrix_17; }
- inline void set_identityMatrix_17(Matrix4x4_t1817901843 value)
- {
- ___identityMatrix_17 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // MATRIX4X4_T1817901843_H
- #ifndef SINGLE_T1397266774_H
- #define SINGLE_T1397266774_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Single
- struct Single_t1397266774
- {
- public:
- // System.Single System.Single::m_value
- float ___m_value_7;
- public:
- inline static int32_t get_offset_of_m_value_7() { return static_cast<int32_t>(offsetof(Single_t1397266774, ___m_value_7)); }
- inline float get_m_value_7() const { return ___m_value_7; }
- inline float* get_address_of_m_value_7() { return &___m_value_7; }
- inline void set_m_value_7(float value)
- {
- ___m_value_7 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // SINGLE_T1397266774_H
- #ifndef NOOPTIONS_T313102519_H
- #define NOOPTIONS_T313102519_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Plugins.Options.NoOptions
- struct NoOptions_t313102519
- {
- public:
- union
- {
- struct
- {
- };
- uint8_t NoOptions_t313102519__padding[1];
- };
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // NOOPTIONS_T313102519_H
- #ifndef DOUBLE_T594665363_H
- #define DOUBLE_T594665363_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Double
- struct Double_t594665363
- {
- public:
- // System.Double System.Double::m_value
- double ___m_value_13;
- public:
- inline static int32_t get_offset_of_m_value_13() { return static_cast<int32_t>(offsetof(Double_t594665363, ___m_value_13)); }
- inline double get_m_value_13() const { return ___m_value_13; }
- inline double* get_address_of_m_value_13() { return &___m_value_13; }
- inline void set_m_value_13(double value)
- {
- ___m_value_13 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // DOUBLE_T594665363_H
- #ifndef COLOR_T2555686324_H
- #define COLOR_T2555686324_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Color
- struct Color_t2555686324
- {
- public:
- // System.Single UnityEngine.Color::r
- float ___r_0;
- // System.Single UnityEngine.Color::g
- float ___g_1;
- // System.Single UnityEngine.Color::b
- float ___b_2;
- // System.Single UnityEngine.Color::a
- float ___a_3;
- public:
- inline static int32_t get_offset_of_r_0() { return static_cast<int32_t>(offsetof(Color_t2555686324, ___r_0)); }
- inline float get_r_0() const { return ___r_0; }
- inline float* get_address_of_r_0() { return &___r_0; }
- inline void set_r_0(float value)
- {
- ___r_0 = value;
- }
- inline static int32_t get_offset_of_g_1() { return static_cast<int32_t>(offsetof(Color_t2555686324, ___g_1)); }
- inline float get_g_1() const { return ___g_1; }
- inline float* get_address_of_g_1() { return &___g_1; }
- inline void set_g_1(float value)
- {
- ___g_1 = value;
- }
- inline static int32_t get_offset_of_b_2() { return static_cast<int32_t>(offsetof(Color_t2555686324, ___b_2)); }
- inline float get_b_2() const { return ___b_2; }
- inline float* get_address_of_b_2() { return &___b_2; }
- inline void set_b_2(float value)
- {
- ___b_2 = value;
- }
- inline static int32_t get_offset_of_a_3() { return static_cast<int32_t>(offsetof(Color_t2555686324, ___a_3)); }
- inline float get_a_3() const { return ___a_3; }
- inline float* get_address_of_a_3() { return &___a_3; }
- inline void set_a_3(float value)
- {
- ___a_3 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // COLOR_T2555686324_H
- #ifndef ENUM_T4135868527_H
- #define ENUM_T4135868527_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Enum
- struct Enum_t4135868527 : public ValueType_t3640485471
- {
- public:
- public:
- };
- struct Enum_t4135868527_StaticFields
- {
- public:
- // System.Char[] System.Enum::split_char
- CharU5BU5D_t3528271667* ___split_char_0;
- public:
- inline static int32_t get_offset_of_split_char_0() { return static_cast<int32_t>(offsetof(Enum_t4135868527_StaticFields, ___split_char_0)); }
- inline CharU5BU5D_t3528271667* get_split_char_0() const { return ___split_char_0; }
- inline CharU5BU5D_t3528271667** get_address_of_split_char_0() { return &___split_char_0; }
- inline void set_split_char_0(CharU5BU5D_t3528271667* value)
- {
- ___split_char_0 = value;
- Il2CppCodeGenWriteBarrier((&___split_char_0), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of System.Enum
- struct Enum_t4135868527_marshaled_pinvoke
- {
- };
- // Native definition for COM marshalling of System.Enum
- struct Enum_t4135868527_marshaled_com
- {
- };
- #endif // ENUM_T4135868527_H
- #ifndef NULLABLE_1_T4278248406_H
- #define NULLABLE_1_T4278248406_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Nullable`1<UnityEngine.Color>
- struct Nullable_1_t4278248406
- {
- public:
- // T System.Nullable`1::value
- Color_t2555686324 ___value_0;
- // System.Boolean System.Nullable`1::has_value
- bool ___has_value_1;
- public:
- inline static int32_t get_offset_of_value_0() { return static_cast<int32_t>(offsetof(Nullable_1_t4278248406, ___value_0)); }
- inline Color_t2555686324 get_value_0() const { return ___value_0; }
- inline Color_t2555686324 * get_address_of_value_0() { return &___value_0; }
- inline void set_value_0(Color_t2555686324 value)
- {
- ___value_0 = value;
- }
- inline static int32_t get_offset_of_has_value_1() { return static_cast<int32_t>(offsetof(Nullable_1_t4278248406, ___has_value_1)); }
- inline bool get_has_value_1() const { return ___has_value_1; }
- inline bool* get_address_of_has_value_1() { return &___has_value_1; }
- inline void set_has_value_1(bool value)
- {
- ___has_value_1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // NULLABLE_1_T4278248406_H
- #ifndef PATHTYPE_T3777299409_H
- #define PATHTYPE_T3777299409_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.PathType
- struct PathType_t3777299409
- {
- public:
- // System.Int32 DG.Tweening.PathType::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(PathType_t3777299409, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // PATHTYPE_T3777299409_H
- #ifndef PATHMODE_T2165603100_H
- #define PATHMODE_T2165603100_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.PathMode
- struct PathMode_t2165603100
- {
- public:
- // System.Int32 DG.Tweening.PathMode::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(PathMode_t2165603100, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // PATHMODE_T2165603100_H
- #ifndef LOOPTYPE_T3049802818_H
- #define LOOPTYPE_T3049802818_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.LoopType
- struct LoopType_t3049802818
- {
- public:
- // System.Int32 DG.Tweening.LoopType::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(LoopType_t3049802818, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // LOOPTYPE_T3049802818_H
- #ifndef UPDATETYPE_T3937729206_H
- #define UPDATETYPE_T3937729206_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.UpdateType
- struct UpdateType_t3937729206
- {
- public:
- // System.Int32 DG.Tweening.UpdateType::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(UpdateType_t3937729206, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // UPDATETYPE_T3937729206_H
- #ifndef SPECIALSTARTUPMODE_T1644068939_H
- #define SPECIALSTARTUPMODE_T1644068939_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Core.Enums.SpecialStartupMode
- struct SpecialStartupMode_t1644068939
- {
- public:
- // System.Int32 DG.Tweening.Core.Enums.SpecialStartupMode::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(SpecialStartupMode_t1644068939, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // SPECIALSTARTUPMODE_T1644068939_H
- #ifndef BINDINGFLAGS_T2721792723_H
- #define BINDINGFLAGS_T2721792723_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Reflection.BindingFlags
- struct BindingFlags_t2721792723
- {
- public:
- // System.Int32 System.Reflection.BindingFlags::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(BindingFlags_t2721792723, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // BINDINGFLAGS_T2721792723_H
- #ifndef ORIENTTYPE_T1731166963_H
- #define ORIENTTYPE_T1731166963_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Plugins.Options.OrientType
- struct OrientType_t1731166963
- {
- public:
- // System.Int32 DG.Tweening.Plugins.Options.OrientType::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(OrientType_t1731166963, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // ORIENTTYPE_T1731166963_H
- #ifndef EASE_T4010715394_H
- #define EASE_T4010715394_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Ease
- struct Ease_t4010715394
- {
- public:
- // System.Int32 DG.Tweening.Ease::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(Ease_t4010715394, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // EASE_T4010715394_H
- #ifndef DELEGATE_T1188392813_H
- #define DELEGATE_T1188392813_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Delegate
- struct Delegate_t1188392813 : public RuntimeObject
- {
- public:
- // System.IntPtr System.Delegate::method_ptr
- Il2CppMethodPointer ___method_ptr_0;
- // System.IntPtr System.Delegate::invoke_impl
- intptr_t ___invoke_impl_1;
- // System.Object System.Delegate::m_target
- RuntimeObject * ___m_target_2;
- // System.IntPtr System.Delegate::method
- intptr_t ___method_3;
- // System.IntPtr System.Delegate::delegate_trampoline
- intptr_t ___delegate_trampoline_4;
- // System.IntPtr System.Delegate::method_code
- intptr_t ___method_code_5;
- // System.Reflection.MethodInfo System.Delegate::method_info
- MethodInfo_t * ___method_info_6;
- // System.Reflection.MethodInfo System.Delegate::original_method_info
- MethodInfo_t * ___original_method_info_7;
- // System.DelegateData System.Delegate::data
- DelegateData_t1677132599 * ___data_8;
- public:
- inline static int32_t get_offset_of_method_ptr_0() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___method_ptr_0)); }
- inline Il2CppMethodPointer get_method_ptr_0() const { return ___method_ptr_0; }
- inline Il2CppMethodPointer* get_address_of_method_ptr_0() { return &___method_ptr_0; }
- inline void set_method_ptr_0(Il2CppMethodPointer value)
- {
- ___method_ptr_0 = value;
- }
- inline static int32_t get_offset_of_invoke_impl_1() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___invoke_impl_1)); }
- inline intptr_t get_invoke_impl_1() const { return ___invoke_impl_1; }
- inline intptr_t* get_address_of_invoke_impl_1() { return &___invoke_impl_1; }
- inline void set_invoke_impl_1(intptr_t value)
- {
- ___invoke_impl_1 = value;
- }
- inline static int32_t get_offset_of_m_target_2() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___m_target_2)); }
- inline RuntimeObject * get_m_target_2() const { return ___m_target_2; }
- inline RuntimeObject ** get_address_of_m_target_2() { return &___m_target_2; }
- inline void set_m_target_2(RuntimeObject * value)
- {
- ___m_target_2 = value;
- Il2CppCodeGenWriteBarrier((&___m_target_2), value);
- }
- inline static int32_t get_offset_of_method_3() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___method_3)); }
- inline intptr_t get_method_3() const { return ___method_3; }
- inline intptr_t* get_address_of_method_3() { return &___method_3; }
- inline void set_method_3(intptr_t value)
- {
- ___method_3 = value;
- }
- inline static int32_t get_offset_of_delegate_trampoline_4() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___delegate_trampoline_4)); }
- inline intptr_t get_delegate_trampoline_4() const { return ___delegate_trampoline_4; }
- inline intptr_t* get_address_of_delegate_trampoline_4() { return &___delegate_trampoline_4; }
- inline void set_delegate_trampoline_4(intptr_t value)
- {
- ___delegate_trampoline_4 = value;
- }
- inline static int32_t get_offset_of_method_code_5() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___method_code_5)); }
- inline intptr_t get_method_code_5() const { return ___method_code_5; }
- inline intptr_t* get_address_of_method_code_5() { return &___method_code_5; }
- inline void set_method_code_5(intptr_t value)
- {
- ___method_code_5 = value;
- }
- inline static int32_t get_offset_of_method_info_6() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___method_info_6)); }
- inline MethodInfo_t * get_method_info_6() const { return ___method_info_6; }
- inline MethodInfo_t ** get_address_of_method_info_6() { return &___method_info_6; }
- inline void set_method_info_6(MethodInfo_t * value)
- {
- ___method_info_6 = value;
- Il2CppCodeGenWriteBarrier((&___method_info_6), value);
- }
- inline static int32_t get_offset_of_original_method_info_7() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___original_method_info_7)); }
- inline MethodInfo_t * get_original_method_info_7() const { return ___original_method_info_7; }
- inline MethodInfo_t ** get_address_of_original_method_info_7() { return &___original_method_info_7; }
- inline void set_original_method_info_7(MethodInfo_t * value)
- {
- ___original_method_info_7 = value;
- Il2CppCodeGenWriteBarrier((&___original_method_info_7), value);
- }
- inline static int32_t get_offset_of_data_8() { return static_cast<int32_t>(offsetof(Delegate_t1188392813, ___data_8)); }
- inline DelegateData_t1677132599 * get_data_8() const { return ___data_8; }
- inline DelegateData_t1677132599 ** get_address_of_data_8() { return &___data_8; }
- inline void set_data_8(DelegateData_t1677132599 * value)
- {
- ___data_8 = value;
- Il2CppCodeGenWriteBarrier((&___data_8), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // DELEGATE_T1188392813_H
- #ifndef NULLABLE_1_T1149908250_H
- #define NULLABLE_1_T1149908250_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Nullable`1<UnityEngine.Vector3>
- struct Nullable_1_t1149908250
- {
- public:
- // T System.Nullable`1::value
- Vector3_t3722313464 ___value_0;
- // System.Boolean System.Nullable`1::has_value
- bool ___has_value_1;
- public:
- inline static int32_t get_offset_of_value_0() { return static_cast<int32_t>(offsetof(Nullable_1_t1149908250, ___value_0)); }
- inline Vector3_t3722313464 get_value_0() const { return ___value_0; }
- inline Vector3_t3722313464 * get_address_of_value_0() { return &___value_0; }
- inline void set_value_0(Vector3_t3722313464 value)
- {
- ___value_0 = value;
- }
- inline static int32_t get_offset_of_has_value_1() { return static_cast<int32_t>(offsetof(Nullable_1_t1149908250, ___has_value_1)); }
- inline bool get_has_value_1() const { return ___has_value_1; }
- inline bool* get_address_of_has_value_1() { return &___has_value_1; }
- inline void set_has_value_1(bool value)
- {
- ___has_value_1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // NULLABLE_1_T1149908250_H
- #ifndef LUATYPES_T3572446928_H
- #define LUATYPES_T3572446928_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.LuaTypes
- struct LuaTypes_t3572446928
- {
- public:
- // System.Int32 XLua.LuaTypes::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(LuaTypes_t3572446928, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // LUATYPES_T3572446928_H
- #ifndef TWEENTYPE_T1971673186_H
- #define TWEENTYPE_T1971673186_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.TweenType
- struct TweenType_t1971673186
- {
- public:
- // System.Int32 DG.Tweening.TweenType::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(TweenType_t1971673186, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEENTYPE_T1971673186_H
- #ifndef SPACE_T654135784_H
- #define SPACE_T654135784_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Space
- struct Space_t654135784
- {
- public:
- // System.Int32 UnityEngine.Space::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(Space_t654135784, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // SPACE_T654135784_H
- #ifndef BOUNDS_T2266837910_H
- #define BOUNDS_T2266837910_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Bounds
- struct Bounds_t2266837910
- {
- public:
- // UnityEngine.Vector3 UnityEngine.Bounds::m_Center
- Vector3_t3722313464 ___m_Center_0;
- // UnityEngine.Vector3 UnityEngine.Bounds::m_Extents
- Vector3_t3722313464 ___m_Extents_1;
- public:
- inline static int32_t get_offset_of_m_Center_0() { return static_cast<int32_t>(offsetof(Bounds_t2266837910, ___m_Center_0)); }
- inline Vector3_t3722313464 get_m_Center_0() const { return ___m_Center_0; }
- inline Vector3_t3722313464 * get_address_of_m_Center_0() { return &___m_Center_0; }
- inline void set_m_Center_0(Vector3_t3722313464 value)
- {
- ___m_Center_0 = value;
- }
- inline static int32_t get_offset_of_m_Extents_1() { return static_cast<int32_t>(offsetof(Bounds_t2266837910, ___m_Extents_1)); }
- inline Vector3_t3722313464 get_m_Extents_1() const { return ___m_Extents_1; }
- inline Vector3_t3722313464 * get_address_of_m_Extents_1() { return &___m_Extents_1; }
- inline void set_m_Extents_1(Vector3_t3722313464 value)
- {
- ___m_Extents_1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // BOUNDS_T2266837910_H
- #ifndef SKINQUALITY_T4231844520_H
- #define SKINQUALITY_T4231844520_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.SkinQuality
- struct SkinQuality_t4231844520
- {
- public:
- // System.Int32 UnityEngine.SkinQuality::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(SkinQuality_t4231844520, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // SKINQUALITY_T4231844520_H
- #ifndef ASYNCOPERATION_T1445031843_H
- #define ASYNCOPERATION_T1445031843_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.AsyncOperation
- struct AsyncOperation_t1445031843 : public YieldInstruction_t403091072
- {
- public:
- // System.IntPtr UnityEngine.AsyncOperation::m_Ptr
- intptr_t ___m_Ptr_0;
- // System.Action`1<UnityEngine.AsyncOperation> UnityEngine.AsyncOperation::m_completeCallback
- Action_1_t1617499438 * ___m_completeCallback_1;
- public:
- inline static int32_t get_offset_of_m_Ptr_0() { return static_cast<int32_t>(offsetof(AsyncOperation_t1445031843, ___m_Ptr_0)); }
- inline intptr_t get_m_Ptr_0() const { return ___m_Ptr_0; }
- inline intptr_t* get_address_of_m_Ptr_0() { return &___m_Ptr_0; }
- inline void set_m_Ptr_0(intptr_t value)
- {
- ___m_Ptr_0 = value;
- }
- inline static int32_t get_offset_of_m_completeCallback_1() { return static_cast<int32_t>(offsetof(AsyncOperation_t1445031843, ___m_completeCallback_1)); }
- inline Action_1_t1617499438 * get_m_completeCallback_1() const { return ___m_completeCallback_1; }
- inline Action_1_t1617499438 ** get_address_of_m_completeCallback_1() { return &___m_completeCallback_1; }
- inline void set_m_completeCallback_1(Action_1_t1617499438 * value)
- {
- ___m_completeCallback_1 = value;
- Il2CppCodeGenWriteBarrier((&___m_completeCallback_1), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of UnityEngine.AsyncOperation
- struct AsyncOperation_t1445031843_marshaled_pinvoke : public YieldInstruction_t403091072_marshaled_pinvoke
- {
- intptr_t ___m_Ptr_0;
- Il2CppMethodPointer ___m_completeCallback_1;
- };
- // Native definition for COM marshalling of UnityEngine.AsyncOperation
- struct AsyncOperation_t1445031843_marshaled_com : public YieldInstruction_t403091072_marshaled_com
- {
- intptr_t ___m_Ptr_0;
- Il2CppMethodPointer ___m_completeCallback_1;
- };
- #endif // ASYNCOPERATION_T1445031843_H
- #ifndef ROTATEMODE_T2548570174_H
- #define ROTATEMODE_T2548570174_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.RotateMode
- struct RotateMode_t2548570174
- {
- public:
- // System.Int32 DG.Tweening.RotateMode::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(RotateMode_t2548570174, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // ROTATEMODE_T2548570174_H
- #ifndef RUNTIMETYPEHANDLE_T3027515415_H
- #define RUNTIMETYPEHANDLE_T3027515415_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.RuntimeTypeHandle
- struct RuntimeTypeHandle_t3027515415
- {
- public:
- // System.IntPtr System.RuntimeTypeHandle::value
- intptr_t ___value_0;
- public:
- inline static int32_t get_offset_of_value_0() { return static_cast<int32_t>(offsetof(RuntimeTypeHandle_t3027515415, ___value_0)); }
- inline intptr_t get_value_0() const { return ___value_0; }
- inline intptr_t* get_address_of_value_0() { return &___value_0; }
- inline void set_value_0(intptr_t value)
- {
- ___value_0 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // RUNTIMETYPEHANDLE_T3027515415_H
- #ifndef AXISCONSTRAINT_T2771958344_H
- #define AXISCONSTRAINT_T2771958344_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.AxisConstraint
- struct AxisConstraint_t2771958344
- {
- public:
- // System.Int32 DG.Tweening.AxisConstraint::value__
- int32_t ___value___1;
- public:
- inline static int32_t get_offset_of_value___1() { return static_cast<int32_t>(offsetof(AxisConstraint_t2771958344, ___value___1)); }
- inline int32_t get_value___1() const { return ___value___1; }
- inline int32_t* get_address_of_value___1() { return &___value___1; }
- inline void set_value___1(int32_t value)
- {
- ___value___1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // AXISCONSTRAINT_T2771958344_H
- #ifndef OBJECTTRANSLATORPOOL_T158158286_H
- #define OBJECTTRANSLATORPOOL_T158158286_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.ObjectTranslatorPool
- struct ObjectTranslatorPool_t158158286 : public RuntimeObject
- {
- public:
- // System.Collections.Generic.Dictionary`2<System.IntPtr,System.WeakReference> XLua.ObjectTranslatorPool::translators
- Dictionary_2_t3851719731 * ___translators_0;
- // System.IntPtr XLua.ObjectTranslatorPool::lastPtr
- intptr_t ___lastPtr_1;
- // XLua.ObjectTranslator XLua.ObjectTranslatorPool::lastTranslator
- ObjectTranslator_t2020767555 * ___lastTranslator_2;
- public:
- inline static int32_t get_offset_of_translators_0() { return static_cast<int32_t>(offsetof(ObjectTranslatorPool_t158158286, ___translators_0)); }
- inline Dictionary_2_t3851719731 * get_translators_0() const { return ___translators_0; }
- inline Dictionary_2_t3851719731 ** get_address_of_translators_0() { return &___translators_0; }
- inline void set_translators_0(Dictionary_2_t3851719731 * value)
- {
- ___translators_0 = value;
- Il2CppCodeGenWriteBarrier((&___translators_0), value);
- }
- inline static int32_t get_offset_of_lastPtr_1() { return static_cast<int32_t>(offsetof(ObjectTranslatorPool_t158158286, ___lastPtr_1)); }
- inline intptr_t get_lastPtr_1() const { return ___lastPtr_1; }
- inline intptr_t* get_address_of_lastPtr_1() { return &___lastPtr_1; }
- inline void set_lastPtr_1(intptr_t value)
- {
- ___lastPtr_1 = value;
- }
- inline static int32_t get_offset_of_lastTranslator_2() { return static_cast<int32_t>(offsetof(ObjectTranslatorPool_t158158286, ___lastTranslator_2)); }
- inline ObjectTranslator_t2020767555 * get_lastTranslator_2() const { return ___lastTranslator_2; }
- inline ObjectTranslator_t2020767555 ** get_address_of_lastTranslator_2() { return &___lastTranslator_2; }
- inline void set_lastTranslator_2(ObjectTranslator_t2020767555 * value)
- {
- ___lastTranslator_2 = value;
- Il2CppCodeGenWriteBarrier((&___lastTranslator_2), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // OBJECTTRANSLATORPOOL_T158158286_H
- #ifndef OBJECT_T631007953_H
- #define OBJECT_T631007953_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Object
- struct Object_t631007953 : public RuntimeObject
- {
- public:
- // System.IntPtr UnityEngine.Object::m_CachedPtr
- intptr_t ___m_CachedPtr_0;
- public:
- inline static int32_t get_offset_of_m_CachedPtr_0() { return static_cast<int32_t>(offsetof(Object_t631007953, ___m_CachedPtr_0)); }
- inline intptr_t get_m_CachedPtr_0() const { return ___m_CachedPtr_0; }
- inline intptr_t* get_address_of_m_CachedPtr_0() { return &___m_CachedPtr_0; }
- inline void set_m_CachedPtr_0(intptr_t value)
- {
- ___m_CachedPtr_0 = value;
- }
- };
- struct Object_t631007953_StaticFields
- {
- public:
- // System.Int32 UnityEngine.Object::OffsetOfInstanceIDInCPlusPlusObject
- int32_t ___OffsetOfInstanceIDInCPlusPlusObject_1;
- public:
- inline static int32_t get_offset_of_OffsetOfInstanceIDInCPlusPlusObject_1() { return static_cast<int32_t>(offsetof(Object_t631007953_StaticFields, ___OffsetOfInstanceIDInCPlusPlusObject_1)); }
- inline int32_t get_OffsetOfInstanceIDInCPlusPlusObject_1() const { return ___OffsetOfInstanceIDInCPlusPlusObject_1; }
- inline int32_t* get_address_of_OffsetOfInstanceIDInCPlusPlusObject_1() { return &___OffsetOfInstanceIDInCPlusPlusObject_1; }
- inline void set_OffsetOfInstanceIDInCPlusPlusObject_1(int32_t value)
- {
- ___OffsetOfInstanceIDInCPlusPlusObject_1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of UnityEngine.Object
- struct Object_t631007953_marshaled_pinvoke
- {
- intptr_t ___m_CachedPtr_0;
- };
- // Native definition for COM marshalling of UnityEngine.Object
- struct Object_t631007953_marshaled_com
- {
- intptr_t ___m_CachedPtr_0;
- };
- #endif // OBJECT_T631007953_H
- #ifndef QUATERNIONOPTIONS_T2974423933_H
- #define QUATERNIONOPTIONS_T2974423933_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Plugins.Options.QuaternionOptions
- struct QuaternionOptions_t2974423933
- {
- public:
- // DG.Tweening.RotateMode DG.Tweening.Plugins.Options.QuaternionOptions::rotateMode
- int32_t ___rotateMode_0;
- // DG.Tweening.AxisConstraint DG.Tweening.Plugins.Options.QuaternionOptions::axisConstraint
- int32_t ___axisConstraint_1;
- // UnityEngine.Vector3 DG.Tweening.Plugins.Options.QuaternionOptions::up
- Vector3_t3722313464 ___up_2;
- public:
- inline static int32_t get_offset_of_rotateMode_0() { return static_cast<int32_t>(offsetof(QuaternionOptions_t2974423933, ___rotateMode_0)); }
- inline int32_t get_rotateMode_0() const { return ___rotateMode_0; }
- inline int32_t* get_address_of_rotateMode_0() { return &___rotateMode_0; }
- inline void set_rotateMode_0(int32_t value)
- {
- ___rotateMode_0 = value;
- }
- inline static int32_t get_offset_of_axisConstraint_1() { return static_cast<int32_t>(offsetof(QuaternionOptions_t2974423933, ___axisConstraint_1)); }
- inline int32_t get_axisConstraint_1() const { return ___axisConstraint_1; }
- inline int32_t* get_address_of_axisConstraint_1() { return &___axisConstraint_1; }
- inline void set_axisConstraint_1(int32_t value)
- {
- ___axisConstraint_1 = value;
- }
- inline static int32_t get_offset_of_up_2() { return static_cast<int32_t>(offsetof(QuaternionOptions_t2974423933, ___up_2)); }
- inline Vector3_t3722313464 get_up_2() const { return ___up_2; }
- inline Vector3_t3722313464 * get_address_of_up_2() { return &___up_2; }
- inline void set_up_2(Vector3_t3722313464 value)
- {
- ___up_2 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // QUATERNIONOPTIONS_T2974423933_H
- #ifndef VECTOROPTIONS_T1354903650_H
- #define VECTOROPTIONS_T1354903650_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Plugins.Options.VectorOptions
- struct VectorOptions_t1354903650
- {
- public:
- // DG.Tweening.AxisConstraint DG.Tweening.Plugins.Options.VectorOptions::axisConstraint
- int32_t ___axisConstraint_0;
- // System.Boolean DG.Tweening.Plugins.Options.VectorOptions::snapping
- bool ___snapping_1;
- public:
- inline static int32_t get_offset_of_axisConstraint_0() { return static_cast<int32_t>(offsetof(VectorOptions_t1354903650, ___axisConstraint_0)); }
- inline int32_t get_axisConstraint_0() const { return ___axisConstraint_0; }
- inline int32_t* get_address_of_axisConstraint_0() { return &___axisConstraint_0; }
- inline void set_axisConstraint_0(int32_t value)
- {
- ___axisConstraint_0 = value;
- }
- inline static int32_t get_offset_of_snapping_1() { return static_cast<int32_t>(offsetof(VectorOptions_t1354903650, ___snapping_1)); }
- inline bool get_snapping_1() const { return ___snapping_1; }
- inline bool* get_address_of_snapping_1() { return &___snapping_1; }
- inline void set_snapping_1(bool value)
- {
- ___snapping_1 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of DG.Tweening.Plugins.Options.VectorOptions
- struct VectorOptions_t1354903650_marshaled_pinvoke
- {
- int32_t ___axisConstraint_0;
- int32_t ___snapping_1;
- };
- // Native definition for COM marshalling of DG.Tweening.Plugins.Options.VectorOptions
- struct VectorOptions_t1354903650_marshaled_com
- {
- int32_t ___axisConstraint_0;
- int32_t ___snapping_1;
- };
- #endif // VECTOROPTIONS_T1354903650_H
- #ifndef RESOURCEREQUEST_T3109103591_H
- #define RESOURCEREQUEST_T3109103591_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.ResourceRequest
- struct ResourceRequest_t3109103591 : public AsyncOperation_t1445031843
- {
- public:
- // System.String UnityEngine.ResourceRequest::m_Path
- String_t* ___m_Path_2;
- // System.Type UnityEngine.ResourceRequest::m_Type
- Type_t * ___m_Type_3;
- public:
- inline static int32_t get_offset_of_m_Path_2() { return static_cast<int32_t>(offsetof(ResourceRequest_t3109103591, ___m_Path_2)); }
- inline String_t* get_m_Path_2() const { return ___m_Path_2; }
- inline String_t** get_address_of_m_Path_2() { return &___m_Path_2; }
- inline void set_m_Path_2(String_t* value)
- {
- ___m_Path_2 = value;
- Il2CppCodeGenWriteBarrier((&___m_Path_2), value);
- }
- inline static int32_t get_offset_of_m_Type_3() { return static_cast<int32_t>(offsetof(ResourceRequest_t3109103591, ___m_Type_3)); }
- inline Type_t * get_m_Type_3() const { return ___m_Type_3; }
- inline Type_t ** get_address_of_m_Type_3() { return &___m_Type_3; }
- inline void set_m_Type_3(Type_t * value)
- {
- ___m_Type_3 = value;
- Il2CppCodeGenWriteBarrier((&___m_Type_3), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of UnityEngine.ResourceRequest
- struct ResourceRequest_t3109103591_marshaled_pinvoke : public AsyncOperation_t1445031843_marshaled_pinvoke
- {
- char* ___m_Path_2;
- Type_t * ___m_Type_3;
- };
- // Native definition for COM marshalling of UnityEngine.ResourceRequest
- struct ResourceRequest_t3109103591_marshaled_com : public AsyncOperation_t1445031843_marshaled_com
- {
- Il2CppChar* ___m_Path_2;
- Type_t * ___m_Type_3;
- };
- #endif // RESOURCEREQUEST_T3109103591_H
- #ifndef TYPE_T_H
- #define TYPE_T_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.Type
- struct Type_t : public MemberInfo_t
- {
- public:
- // System.RuntimeTypeHandle System.Type::_impl
- RuntimeTypeHandle_t3027515415 ____impl_1;
- public:
- inline static int32_t get_offset_of__impl_1() { return static_cast<int32_t>(offsetof(Type_t, ____impl_1)); }
- inline RuntimeTypeHandle_t3027515415 get__impl_1() const { return ____impl_1; }
- inline RuntimeTypeHandle_t3027515415 * get_address_of__impl_1() { return &____impl_1; }
- inline void set__impl_1(RuntimeTypeHandle_t3027515415 value)
- {
- ____impl_1 = value;
- }
- };
- struct Type_t_StaticFields
- {
- public:
- // System.Char System.Type::Delimiter
- Il2CppChar ___Delimiter_2;
- // System.Type[] System.Type::EmptyTypes
- TypeU5BU5D_t3940880105* ___EmptyTypes_3;
- // System.Reflection.MemberFilter System.Type::FilterAttribute
- MemberFilter_t426314064 * ___FilterAttribute_4;
- // System.Reflection.MemberFilter System.Type::FilterName
- MemberFilter_t426314064 * ___FilterName_5;
- // System.Reflection.MemberFilter System.Type::FilterNameIgnoreCase
- MemberFilter_t426314064 * ___FilterNameIgnoreCase_6;
- // System.Object System.Type::Missing
- RuntimeObject * ___Missing_7;
- public:
- inline static int32_t get_offset_of_Delimiter_2() { return static_cast<int32_t>(offsetof(Type_t_StaticFields, ___Delimiter_2)); }
- inline Il2CppChar get_Delimiter_2() const { return ___Delimiter_2; }
- inline Il2CppChar* get_address_of_Delimiter_2() { return &___Delimiter_2; }
- inline void set_Delimiter_2(Il2CppChar value)
- {
- ___Delimiter_2 = value;
- }
- inline static int32_t get_offset_of_EmptyTypes_3() { return static_cast<int32_t>(offsetof(Type_t_StaticFields, ___EmptyTypes_3)); }
- inline TypeU5BU5D_t3940880105* get_EmptyTypes_3() const { return ___EmptyTypes_3; }
- inline TypeU5BU5D_t3940880105** get_address_of_EmptyTypes_3() { return &___EmptyTypes_3; }
- inline void set_EmptyTypes_3(TypeU5BU5D_t3940880105* value)
- {
- ___EmptyTypes_3 = value;
- Il2CppCodeGenWriteBarrier((&___EmptyTypes_3), value);
- }
- inline static int32_t get_offset_of_FilterAttribute_4() { return static_cast<int32_t>(offsetof(Type_t_StaticFields, ___FilterAttribute_4)); }
- inline MemberFilter_t426314064 * get_FilterAttribute_4() const { return ___FilterAttribute_4; }
- inline MemberFilter_t426314064 ** get_address_of_FilterAttribute_4() { return &___FilterAttribute_4; }
- inline void set_FilterAttribute_4(MemberFilter_t426314064 * value)
- {
- ___FilterAttribute_4 = value;
- Il2CppCodeGenWriteBarrier((&___FilterAttribute_4), value);
- }
- inline static int32_t get_offset_of_FilterName_5() { return static_cast<int32_t>(offsetof(Type_t_StaticFields, ___FilterName_5)); }
- inline MemberFilter_t426314064 * get_FilterName_5() const { return ___FilterName_5; }
- inline MemberFilter_t426314064 ** get_address_of_FilterName_5() { return &___FilterName_5; }
- inline void set_FilterName_5(MemberFilter_t426314064 * value)
- {
- ___FilterName_5 = value;
- Il2CppCodeGenWriteBarrier((&___FilterName_5), value);
- }
- inline static int32_t get_offset_of_FilterNameIgnoreCase_6() { return static_cast<int32_t>(offsetof(Type_t_StaticFields, ___FilterNameIgnoreCase_6)); }
- inline MemberFilter_t426314064 * get_FilterNameIgnoreCase_6() const { return ___FilterNameIgnoreCase_6; }
- inline MemberFilter_t426314064 ** get_address_of_FilterNameIgnoreCase_6() { return &___FilterNameIgnoreCase_6; }
- inline void set_FilterNameIgnoreCase_6(MemberFilter_t426314064 * value)
- {
- ___FilterNameIgnoreCase_6 = value;
- Il2CppCodeGenWriteBarrier((&___FilterNameIgnoreCase_6), value);
- }
- inline static int32_t get_offset_of_Missing_7() { return static_cast<int32_t>(offsetof(Type_t_StaticFields, ___Missing_7)); }
- inline RuntimeObject * get_Missing_7() const { return ___Missing_7; }
- inline RuntimeObject ** get_address_of_Missing_7() { return &___Missing_7; }
- inline void set_Missing_7(RuntimeObject * value)
- {
- ___Missing_7 = value;
- Il2CppCodeGenWriteBarrier((&___Missing_7), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TYPE_T_H
- #ifndef PATHOPTIONS_T2074623791_H
- #define PATHOPTIONS_T2074623791_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Plugins.Options.PathOptions
- struct PathOptions_t2074623791
- {
- public:
- // DG.Tweening.PathMode DG.Tweening.Plugins.Options.PathOptions::mode
- int32_t ___mode_0;
- // DG.Tweening.Plugins.Options.OrientType DG.Tweening.Plugins.Options.PathOptions::orientType
- int32_t ___orientType_1;
- // DG.Tweening.AxisConstraint DG.Tweening.Plugins.Options.PathOptions::lockPositionAxis
- int32_t ___lockPositionAxis_2;
- // DG.Tweening.AxisConstraint DG.Tweening.Plugins.Options.PathOptions::lockRotationAxis
- int32_t ___lockRotationAxis_3;
- // System.Boolean DG.Tweening.Plugins.Options.PathOptions::isClosedPath
- bool ___isClosedPath_4;
- // UnityEngine.Vector3 DG.Tweening.Plugins.Options.PathOptions::lookAtPosition
- Vector3_t3722313464 ___lookAtPosition_5;
- // UnityEngine.Transform DG.Tweening.Plugins.Options.PathOptions::lookAtTransform
- Transform_t3600365921 * ___lookAtTransform_6;
- // System.Single DG.Tweening.Plugins.Options.PathOptions::lookAhead
- float ___lookAhead_7;
- // System.Boolean DG.Tweening.Plugins.Options.PathOptions::hasCustomForwardDirection
- bool ___hasCustomForwardDirection_8;
- // UnityEngine.Quaternion DG.Tweening.Plugins.Options.PathOptions::forward
- Quaternion_t2301928331 ___forward_9;
- // System.Boolean DG.Tweening.Plugins.Options.PathOptions::useLocalPosition
- bool ___useLocalPosition_10;
- // UnityEngine.Transform DG.Tweening.Plugins.Options.PathOptions::parent
- Transform_t3600365921 * ___parent_11;
- // System.Boolean DG.Tweening.Plugins.Options.PathOptions::isRigidbody
- bool ___isRigidbody_12;
- // UnityEngine.Quaternion DG.Tweening.Plugins.Options.PathOptions::startupRot
- Quaternion_t2301928331 ___startupRot_13;
- // System.Single DG.Tweening.Plugins.Options.PathOptions::startupZRot
- float ___startupZRot_14;
- // System.Boolean DG.Tweening.Plugins.Options.PathOptions::addedExtraStartWp
- bool ___addedExtraStartWp_15;
- // System.Boolean DG.Tweening.Plugins.Options.PathOptions::addedExtraEndWp
- bool ___addedExtraEndWp_16;
- public:
- inline static int32_t get_offset_of_mode_0() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___mode_0)); }
- inline int32_t get_mode_0() const { return ___mode_0; }
- inline int32_t* get_address_of_mode_0() { return &___mode_0; }
- inline void set_mode_0(int32_t value)
- {
- ___mode_0 = value;
- }
- inline static int32_t get_offset_of_orientType_1() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___orientType_1)); }
- inline int32_t get_orientType_1() const { return ___orientType_1; }
- inline int32_t* get_address_of_orientType_1() { return &___orientType_1; }
- inline void set_orientType_1(int32_t value)
- {
- ___orientType_1 = value;
- }
- inline static int32_t get_offset_of_lockPositionAxis_2() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___lockPositionAxis_2)); }
- inline int32_t get_lockPositionAxis_2() const { return ___lockPositionAxis_2; }
- inline int32_t* get_address_of_lockPositionAxis_2() { return &___lockPositionAxis_2; }
- inline void set_lockPositionAxis_2(int32_t value)
- {
- ___lockPositionAxis_2 = value;
- }
- inline static int32_t get_offset_of_lockRotationAxis_3() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___lockRotationAxis_3)); }
- inline int32_t get_lockRotationAxis_3() const { return ___lockRotationAxis_3; }
- inline int32_t* get_address_of_lockRotationAxis_3() { return &___lockRotationAxis_3; }
- inline void set_lockRotationAxis_3(int32_t value)
- {
- ___lockRotationAxis_3 = value;
- }
- inline static int32_t get_offset_of_isClosedPath_4() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___isClosedPath_4)); }
- inline bool get_isClosedPath_4() const { return ___isClosedPath_4; }
- inline bool* get_address_of_isClosedPath_4() { return &___isClosedPath_4; }
- inline void set_isClosedPath_4(bool value)
- {
- ___isClosedPath_4 = value;
- }
- inline static int32_t get_offset_of_lookAtPosition_5() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___lookAtPosition_5)); }
- inline Vector3_t3722313464 get_lookAtPosition_5() const { return ___lookAtPosition_5; }
- inline Vector3_t3722313464 * get_address_of_lookAtPosition_5() { return &___lookAtPosition_5; }
- inline void set_lookAtPosition_5(Vector3_t3722313464 value)
- {
- ___lookAtPosition_5 = value;
- }
- inline static int32_t get_offset_of_lookAtTransform_6() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___lookAtTransform_6)); }
- inline Transform_t3600365921 * get_lookAtTransform_6() const { return ___lookAtTransform_6; }
- inline Transform_t3600365921 ** get_address_of_lookAtTransform_6() { return &___lookAtTransform_6; }
- inline void set_lookAtTransform_6(Transform_t3600365921 * value)
- {
- ___lookAtTransform_6 = value;
- Il2CppCodeGenWriteBarrier((&___lookAtTransform_6), value);
- }
- inline static int32_t get_offset_of_lookAhead_7() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___lookAhead_7)); }
- inline float get_lookAhead_7() const { return ___lookAhead_7; }
- inline float* get_address_of_lookAhead_7() { return &___lookAhead_7; }
- inline void set_lookAhead_7(float value)
- {
- ___lookAhead_7 = value;
- }
- inline static int32_t get_offset_of_hasCustomForwardDirection_8() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___hasCustomForwardDirection_8)); }
- inline bool get_hasCustomForwardDirection_8() const { return ___hasCustomForwardDirection_8; }
- inline bool* get_address_of_hasCustomForwardDirection_8() { return &___hasCustomForwardDirection_8; }
- inline void set_hasCustomForwardDirection_8(bool value)
- {
- ___hasCustomForwardDirection_8 = value;
- }
- inline static int32_t get_offset_of_forward_9() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___forward_9)); }
- inline Quaternion_t2301928331 get_forward_9() const { return ___forward_9; }
- inline Quaternion_t2301928331 * get_address_of_forward_9() { return &___forward_9; }
- inline void set_forward_9(Quaternion_t2301928331 value)
- {
- ___forward_9 = value;
- }
- inline static int32_t get_offset_of_useLocalPosition_10() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___useLocalPosition_10)); }
- inline bool get_useLocalPosition_10() const { return ___useLocalPosition_10; }
- inline bool* get_address_of_useLocalPosition_10() { return &___useLocalPosition_10; }
- inline void set_useLocalPosition_10(bool value)
- {
- ___useLocalPosition_10 = value;
- }
- inline static int32_t get_offset_of_parent_11() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___parent_11)); }
- inline Transform_t3600365921 * get_parent_11() const { return ___parent_11; }
- inline Transform_t3600365921 ** get_address_of_parent_11() { return &___parent_11; }
- inline void set_parent_11(Transform_t3600365921 * value)
- {
- ___parent_11 = value;
- Il2CppCodeGenWriteBarrier((&___parent_11), value);
- }
- inline static int32_t get_offset_of_isRigidbody_12() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___isRigidbody_12)); }
- inline bool get_isRigidbody_12() const { return ___isRigidbody_12; }
- inline bool* get_address_of_isRigidbody_12() { return &___isRigidbody_12; }
- inline void set_isRigidbody_12(bool value)
- {
- ___isRigidbody_12 = value;
- }
- inline static int32_t get_offset_of_startupRot_13() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___startupRot_13)); }
- inline Quaternion_t2301928331 get_startupRot_13() const { return ___startupRot_13; }
- inline Quaternion_t2301928331 * get_address_of_startupRot_13() { return &___startupRot_13; }
- inline void set_startupRot_13(Quaternion_t2301928331 value)
- {
- ___startupRot_13 = value;
- }
- inline static int32_t get_offset_of_startupZRot_14() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___startupZRot_14)); }
- inline float get_startupZRot_14() const { return ___startupZRot_14; }
- inline float* get_address_of_startupZRot_14() { return &___startupZRot_14; }
- inline void set_startupZRot_14(float value)
- {
- ___startupZRot_14 = value;
- }
- inline static int32_t get_offset_of_addedExtraStartWp_15() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___addedExtraStartWp_15)); }
- inline bool get_addedExtraStartWp_15() const { return ___addedExtraStartWp_15; }
- inline bool* get_address_of_addedExtraStartWp_15() { return &___addedExtraStartWp_15; }
- inline void set_addedExtraStartWp_15(bool value)
- {
- ___addedExtraStartWp_15 = value;
- }
- inline static int32_t get_offset_of_addedExtraEndWp_16() { return static_cast<int32_t>(offsetof(PathOptions_t2074623791, ___addedExtraEndWp_16)); }
- inline bool get_addedExtraEndWp_16() const { return ___addedExtraEndWp_16; }
- inline bool* get_address_of_addedExtraEndWp_16() { return &___addedExtraEndWp_16; }
- inline void set_addedExtraEndWp_16(bool value)
- {
- ___addedExtraEndWp_16 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- // Native definition for P/Invoke marshalling of DG.Tweening.Plugins.Options.PathOptions
- struct PathOptions_t2074623791_marshaled_pinvoke
- {
- int32_t ___mode_0;
- int32_t ___orientType_1;
- int32_t ___lockPositionAxis_2;
- int32_t ___lockRotationAxis_3;
- int32_t ___isClosedPath_4;
- Vector3_t3722313464 ___lookAtPosition_5;
- Transform_t3600365921 * ___lookAtTransform_6;
- float ___lookAhead_7;
- int32_t ___hasCustomForwardDirection_8;
- Quaternion_t2301928331 ___forward_9;
- int32_t ___useLocalPosition_10;
- Transform_t3600365921 * ___parent_11;
- int32_t ___isRigidbody_12;
- Quaternion_t2301928331 ___startupRot_13;
- float ___startupZRot_14;
- int32_t ___addedExtraStartWp_15;
- int32_t ___addedExtraEndWp_16;
- };
- // Native definition for COM marshalling of DG.Tweening.Plugins.Options.PathOptions
- struct PathOptions_t2074623791_marshaled_com
- {
- int32_t ___mode_0;
- int32_t ___orientType_1;
- int32_t ___lockPositionAxis_2;
- int32_t ___lockRotationAxis_3;
- int32_t ___isClosedPath_4;
- Vector3_t3722313464 ___lookAtPosition_5;
- Transform_t3600365921 * ___lookAtTransform_6;
- float ___lookAhead_7;
- int32_t ___hasCustomForwardDirection_8;
- Quaternion_t2301928331 ___forward_9;
- int32_t ___useLocalPosition_10;
- Transform_t3600365921 * ___parent_11;
- int32_t ___isRigidbody_12;
- Quaternion_t2301928331 ___startupRot_13;
- float ___startupZRot_14;
- int32_t ___addedExtraStartWp_15;
- int32_t ___addedExtraEndWp_16;
- };
- #endif // PATHOPTIONS_T2074623791_H
- #ifndef ABSSEQUENTIABLE_T3376041011_H
- #define ABSSEQUENTIABLE_T3376041011_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Core.ABSSequentiable
- struct ABSSequentiable_t3376041011 : public RuntimeObject
- {
- public:
- // DG.Tweening.TweenType DG.Tweening.Core.ABSSequentiable::tweenType
- int32_t ___tweenType_0;
- // System.Single DG.Tweening.Core.ABSSequentiable::sequencedPosition
- float ___sequencedPosition_1;
- // System.Single DG.Tweening.Core.ABSSequentiable::sequencedEndPosition
- float ___sequencedEndPosition_2;
- // DG.Tweening.TweenCallback DG.Tweening.Core.ABSSequentiable::onStart
- TweenCallback_t3727756325 * ___onStart_3;
- public:
- inline static int32_t get_offset_of_tweenType_0() { return static_cast<int32_t>(offsetof(ABSSequentiable_t3376041011, ___tweenType_0)); }
- inline int32_t get_tweenType_0() const { return ___tweenType_0; }
- inline int32_t* get_address_of_tweenType_0() { return &___tweenType_0; }
- inline void set_tweenType_0(int32_t value)
- {
- ___tweenType_0 = value;
- }
- inline static int32_t get_offset_of_sequencedPosition_1() { return static_cast<int32_t>(offsetof(ABSSequentiable_t3376041011, ___sequencedPosition_1)); }
- inline float get_sequencedPosition_1() const { return ___sequencedPosition_1; }
- inline float* get_address_of_sequencedPosition_1() { return &___sequencedPosition_1; }
- inline void set_sequencedPosition_1(float value)
- {
- ___sequencedPosition_1 = value;
- }
- inline static int32_t get_offset_of_sequencedEndPosition_2() { return static_cast<int32_t>(offsetof(ABSSequentiable_t3376041011, ___sequencedEndPosition_2)); }
- inline float get_sequencedEndPosition_2() const { return ___sequencedEndPosition_2; }
- inline float* get_address_of_sequencedEndPosition_2() { return &___sequencedEndPosition_2; }
- inline void set_sequencedEndPosition_2(float value)
- {
- ___sequencedEndPosition_2 = value;
- }
- inline static int32_t get_offset_of_onStart_3() { return static_cast<int32_t>(offsetof(ABSSequentiable_t3376041011, ___onStart_3)); }
- inline TweenCallback_t3727756325 * get_onStart_3() const { return ___onStart_3; }
- inline TweenCallback_t3727756325 ** get_address_of_onStart_3() { return &___onStart_3; }
- inline void set_onStart_3(TweenCallback_t3727756325 * value)
- {
- ___onStart_3 = value;
- Il2CppCodeGenWriteBarrier((&___onStart_3), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // ABSSEQUENTIABLE_T3376041011_H
- #ifndef COMPONENT_T1923634451_H
- #define COMPONENT_T1923634451_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Component
- struct Component_t1923634451 : public Object_t631007953
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // COMPONENT_T1923634451_H
- #ifndef PATH_T3614338981_H
- #define PATH_T3614338981_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Plugins.Core.PathCore.Path
- struct Path_t3614338981 : public RuntimeObject
- {
- public:
- // System.Single[] DG.Tweening.Plugins.Core.PathCore.Path::wpLengths
- SingleU5BU5D_t1444911251* ___wpLengths_3;
- // DG.Tweening.PathType DG.Tweening.Plugins.Core.PathCore.Path::type
- int32_t ___type_4;
- // System.Int32 DG.Tweening.Plugins.Core.PathCore.Path::subdivisionsXSegment
- int32_t ___subdivisionsXSegment_5;
- // System.Int32 DG.Tweening.Plugins.Core.PathCore.Path::subdivisions
- int32_t ___subdivisions_6;
- // UnityEngine.Vector3[] DG.Tweening.Plugins.Core.PathCore.Path::wps
- Vector3U5BU5D_t1718750761* ___wps_7;
- // DG.Tweening.Plugins.Core.PathCore.ControlPoint[] DG.Tweening.Plugins.Core.PathCore.Path::controlPoints
- ControlPointU5BU5D_t1567961855* ___controlPoints_8;
- // System.Single DG.Tweening.Plugins.Core.PathCore.Path::length
- float ___length_9;
- // System.Boolean DG.Tweening.Plugins.Core.PathCore.Path::isFinalized
- bool ___isFinalized_10;
- // System.Single[] DG.Tweening.Plugins.Core.PathCore.Path::timesTable
- SingleU5BU5D_t1444911251* ___timesTable_11;
- // System.Single[] DG.Tweening.Plugins.Core.PathCore.Path::lengthsTable
- SingleU5BU5D_t1444911251* ___lengthsTable_12;
- // System.Int32 DG.Tweening.Plugins.Core.PathCore.Path::linearWPIndex
- int32_t ___linearWPIndex_13;
- // System.Boolean DG.Tweening.Plugins.Core.PathCore.Path::addedExtraStartWp
- bool ___addedExtraStartWp_14;
- // System.Boolean DG.Tweening.Plugins.Core.PathCore.Path::addedExtraEndWp
- bool ___addedExtraEndWp_15;
- // DG.Tweening.Plugins.Core.PathCore.Path DG.Tweening.Plugins.Core.PathCore.Path::_incrementalClone
- Path_t3614338981 * ____incrementalClone_16;
- // System.Int32 DG.Tweening.Plugins.Core.PathCore.Path::_incrementalIndex
- int32_t ____incrementalIndex_17;
- // DG.Tweening.Plugins.Core.PathCore.ABSPathDecoder DG.Tweening.Plugins.Core.PathCore.Path::_decoder
- ABSPathDecoder_t2613982196 * ____decoder_18;
- // System.Boolean DG.Tweening.Plugins.Core.PathCore.Path::_changed
- bool ____changed_19;
- // UnityEngine.Vector3[] DG.Tweening.Plugins.Core.PathCore.Path::nonLinearDrawWps
- Vector3U5BU5D_t1718750761* ___nonLinearDrawWps_20;
- // UnityEngine.Vector3 DG.Tweening.Plugins.Core.PathCore.Path::targetPosition
- Vector3_t3722313464 ___targetPosition_21;
- // System.Nullable`1<UnityEngine.Vector3> DG.Tweening.Plugins.Core.PathCore.Path::lookAtPosition
- Nullable_1_t1149908250 ___lookAtPosition_22;
- // UnityEngine.Color DG.Tweening.Plugins.Core.PathCore.Path::gizmoColor
- Color_t2555686324 ___gizmoColor_23;
- public:
- inline static int32_t get_offset_of_wpLengths_3() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___wpLengths_3)); }
- inline SingleU5BU5D_t1444911251* get_wpLengths_3() const { return ___wpLengths_3; }
- inline SingleU5BU5D_t1444911251** get_address_of_wpLengths_3() { return &___wpLengths_3; }
- inline void set_wpLengths_3(SingleU5BU5D_t1444911251* value)
- {
- ___wpLengths_3 = value;
- Il2CppCodeGenWriteBarrier((&___wpLengths_3), value);
- }
- inline static int32_t get_offset_of_type_4() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___type_4)); }
- inline int32_t get_type_4() const { return ___type_4; }
- inline int32_t* get_address_of_type_4() { return &___type_4; }
- inline void set_type_4(int32_t value)
- {
- ___type_4 = value;
- }
- inline static int32_t get_offset_of_subdivisionsXSegment_5() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___subdivisionsXSegment_5)); }
- inline int32_t get_subdivisionsXSegment_5() const { return ___subdivisionsXSegment_5; }
- inline int32_t* get_address_of_subdivisionsXSegment_5() { return &___subdivisionsXSegment_5; }
- inline void set_subdivisionsXSegment_5(int32_t value)
- {
- ___subdivisionsXSegment_5 = value;
- }
- inline static int32_t get_offset_of_subdivisions_6() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___subdivisions_6)); }
- inline int32_t get_subdivisions_6() const { return ___subdivisions_6; }
- inline int32_t* get_address_of_subdivisions_6() { return &___subdivisions_6; }
- inline void set_subdivisions_6(int32_t value)
- {
- ___subdivisions_6 = value;
- }
- inline static int32_t get_offset_of_wps_7() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___wps_7)); }
- inline Vector3U5BU5D_t1718750761* get_wps_7() const { return ___wps_7; }
- inline Vector3U5BU5D_t1718750761** get_address_of_wps_7() { return &___wps_7; }
- inline void set_wps_7(Vector3U5BU5D_t1718750761* value)
- {
- ___wps_7 = value;
- Il2CppCodeGenWriteBarrier((&___wps_7), value);
- }
- inline static int32_t get_offset_of_controlPoints_8() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___controlPoints_8)); }
- inline ControlPointU5BU5D_t1567961855* get_controlPoints_8() const { return ___controlPoints_8; }
- inline ControlPointU5BU5D_t1567961855** get_address_of_controlPoints_8() { return &___controlPoints_8; }
- inline void set_controlPoints_8(ControlPointU5BU5D_t1567961855* value)
- {
- ___controlPoints_8 = value;
- Il2CppCodeGenWriteBarrier((&___controlPoints_8), value);
- }
- inline static int32_t get_offset_of_length_9() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___length_9)); }
- inline float get_length_9() const { return ___length_9; }
- inline float* get_address_of_length_9() { return &___length_9; }
- inline void set_length_9(float value)
- {
- ___length_9 = value;
- }
- inline static int32_t get_offset_of_isFinalized_10() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___isFinalized_10)); }
- inline bool get_isFinalized_10() const { return ___isFinalized_10; }
- inline bool* get_address_of_isFinalized_10() { return &___isFinalized_10; }
- inline void set_isFinalized_10(bool value)
- {
- ___isFinalized_10 = value;
- }
- inline static int32_t get_offset_of_timesTable_11() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___timesTable_11)); }
- inline SingleU5BU5D_t1444911251* get_timesTable_11() const { return ___timesTable_11; }
- inline SingleU5BU5D_t1444911251** get_address_of_timesTable_11() { return &___timesTable_11; }
- inline void set_timesTable_11(SingleU5BU5D_t1444911251* value)
- {
- ___timesTable_11 = value;
- Il2CppCodeGenWriteBarrier((&___timesTable_11), value);
- }
- inline static int32_t get_offset_of_lengthsTable_12() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___lengthsTable_12)); }
- inline SingleU5BU5D_t1444911251* get_lengthsTable_12() const { return ___lengthsTable_12; }
- inline SingleU5BU5D_t1444911251** get_address_of_lengthsTable_12() { return &___lengthsTable_12; }
- inline void set_lengthsTable_12(SingleU5BU5D_t1444911251* value)
- {
- ___lengthsTable_12 = value;
- Il2CppCodeGenWriteBarrier((&___lengthsTable_12), value);
- }
- inline static int32_t get_offset_of_linearWPIndex_13() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___linearWPIndex_13)); }
- inline int32_t get_linearWPIndex_13() const { return ___linearWPIndex_13; }
- inline int32_t* get_address_of_linearWPIndex_13() { return &___linearWPIndex_13; }
- inline void set_linearWPIndex_13(int32_t value)
- {
- ___linearWPIndex_13 = value;
- }
- inline static int32_t get_offset_of_addedExtraStartWp_14() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___addedExtraStartWp_14)); }
- inline bool get_addedExtraStartWp_14() const { return ___addedExtraStartWp_14; }
- inline bool* get_address_of_addedExtraStartWp_14() { return &___addedExtraStartWp_14; }
- inline void set_addedExtraStartWp_14(bool value)
- {
- ___addedExtraStartWp_14 = value;
- }
- inline static int32_t get_offset_of_addedExtraEndWp_15() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___addedExtraEndWp_15)); }
- inline bool get_addedExtraEndWp_15() const { return ___addedExtraEndWp_15; }
- inline bool* get_address_of_addedExtraEndWp_15() { return &___addedExtraEndWp_15; }
- inline void set_addedExtraEndWp_15(bool value)
- {
- ___addedExtraEndWp_15 = value;
- }
- inline static int32_t get_offset_of__incrementalClone_16() { return static_cast<int32_t>(offsetof(Path_t3614338981, ____incrementalClone_16)); }
- inline Path_t3614338981 * get__incrementalClone_16() const { return ____incrementalClone_16; }
- inline Path_t3614338981 ** get_address_of__incrementalClone_16() { return &____incrementalClone_16; }
- inline void set__incrementalClone_16(Path_t3614338981 * value)
- {
- ____incrementalClone_16 = value;
- Il2CppCodeGenWriteBarrier((&____incrementalClone_16), value);
- }
- inline static int32_t get_offset_of__incrementalIndex_17() { return static_cast<int32_t>(offsetof(Path_t3614338981, ____incrementalIndex_17)); }
- inline int32_t get__incrementalIndex_17() const { return ____incrementalIndex_17; }
- inline int32_t* get_address_of__incrementalIndex_17() { return &____incrementalIndex_17; }
- inline void set__incrementalIndex_17(int32_t value)
- {
- ____incrementalIndex_17 = value;
- }
- inline static int32_t get_offset_of__decoder_18() { return static_cast<int32_t>(offsetof(Path_t3614338981, ____decoder_18)); }
- inline ABSPathDecoder_t2613982196 * get__decoder_18() const { return ____decoder_18; }
- inline ABSPathDecoder_t2613982196 ** get_address_of__decoder_18() { return &____decoder_18; }
- inline void set__decoder_18(ABSPathDecoder_t2613982196 * value)
- {
- ____decoder_18 = value;
- Il2CppCodeGenWriteBarrier((&____decoder_18), value);
- }
- inline static int32_t get_offset_of__changed_19() { return static_cast<int32_t>(offsetof(Path_t3614338981, ____changed_19)); }
- inline bool get__changed_19() const { return ____changed_19; }
- inline bool* get_address_of__changed_19() { return &____changed_19; }
- inline void set__changed_19(bool value)
- {
- ____changed_19 = value;
- }
- inline static int32_t get_offset_of_nonLinearDrawWps_20() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___nonLinearDrawWps_20)); }
- inline Vector3U5BU5D_t1718750761* get_nonLinearDrawWps_20() const { return ___nonLinearDrawWps_20; }
- inline Vector3U5BU5D_t1718750761** get_address_of_nonLinearDrawWps_20() { return &___nonLinearDrawWps_20; }
- inline void set_nonLinearDrawWps_20(Vector3U5BU5D_t1718750761* value)
- {
- ___nonLinearDrawWps_20 = value;
- Il2CppCodeGenWriteBarrier((&___nonLinearDrawWps_20), value);
- }
- inline static int32_t get_offset_of_targetPosition_21() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___targetPosition_21)); }
- inline Vector3_t3722313464 get_targetPosition_21() const { return ___targetPosition_21; }
- inline Vector3_t3722313464 * get_address_of_targetPosition_21() { return &___targetPosition_21; }
- inline void set_targetPosition_21(Vector3_t3722313464 value)
- {
- ___targetPosition_21 = value;
- }
- inline static int32_t get_offset_of_lookAtPosition_22() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___lookAtPosition_22)); }
- inline Nullable_1_t1149908250 get_lookAtPosition_22() const { return ___lookAtPosition_22; }
- inline Nullable_1_t1149908250 * get_address_of_lookAtPosition_22() { return &___lookAtPosition_22; }
- inline void set_lookAtPosition_22(Nullable_1_t1149908250 value)
- {
- ___lookAtPosition_22 = value;
- }
- inline static int32_t get_offset_of_gizmoColor_23() { return static_cast<int32_t>(offsetof(Path_t3614338981, ___gizmoColor_23)); }
- inline Color_t2555686324 get_gizmoColor_23() const { return ___gizmoColor_23; }
- inline Color_t2555686324 * get_address_of_gizmoColor_23() { return &___gizmoColor_23; }
- inline void set_gizmoColor_23(Color_t2555686324 value)
- {
- ___gizmoColor_23 = value;
- }
- };
- struct Path_t3614338981_StaticFields
- {
- public:
- // DG.Tweening.Plugins.Core.PathCore.CatmullRomDecoder DG.Tweening.Plugins.Core.PathCore.Path::_catmullRomDecoder
- CatmullRomDecoder_t2053048079 * ____catmullRomDecoder_0;
- // DG.Tweening.Plugins.Core.PathCore.LinearDecoder DG.Tweening.Plugins.Core.PathCore.Path::_linearDecoder
- LinearDecoder_t2708327777 * ____linearDecoder_1;
- // DG.Tweening.Plugins.Core.PathCore.CubicBezierDecoder DG.Tweening.Plugins.Core.PathCore.Path::_cubicBezierDecoder
- CubicBezierDecoder_t2663863244 * ____cubicBezierDecoder_2;
- public:
- inline static int32_t get_offset_of__catmullRomDecoder_0() { return static_cast<int32_t>(offsetof(Path_t3614338981_StaticFields, ____catmullRomDecoder_0)); }
- inline CatmullRomDecoder_t2053048079 * get__catmullRomDecoder_0() const { return ____catmullRomDecoder_0; }
- inline CatmullRomDecoder_t2053048079 ** get_address_of__catmullRomDecoder_0() { return &____catmullRomDecoder_0; }
- inline void set__catmullRomDecoder_0(CatmullRomDecoder_t2053048079 * value)
- {
- ____catmullRomDecoder_0 = value;
- Il2CppCodeGenWriteBarrier((&____catmullRomDecoder_0), value);
- }
- inline static int32_t get_offset_of__linearDecoder_1() { return static_cast<int32_t>(offsetof(Path_t3614338981_StaticFields, ____linearDecoder_1)); }
- inline LinearDecoder_t2708327777 * get__linearDecoder_1() const { return ____linearDecoder_1; }
- inline LinearDecoder_t2708327777 ** get_address_of__linearDecoder_1() { return &____linearDecoder_1; }
- inline void set__linearDecoder_1(LinearDecoder_t2708327777 * value)
- {
- ____linearDecoder_1 = value;
- Il2CppCodeGenWriteBarrier((&____linearDecoder_1), value);
- }
- inline static int32_t get_offset_of__cubicBezierDecoder_2() { return static_cast<int32_t>(offsetof(Path_t3614338981_StaticFields, ____cubicBezierDecoder_2)); }
- inline CubicBezierDecoder_t2663863244 * get__cubicBezierDecoder_2() const { return ____cubicBezierDecoder_2; }
- inline CubicBezierDecoder_t2663863244 ** get_address_of__cubicBezierDecoder_2() { return &____cubicBezierDecoder_2; }
- inline void set__cubicBezierDecoder_2(CubicBezierDecoder_t2663863244 * value)
- {
- ____cubicBezierDecoder_2 = value;
- Il2CppCodeGenWriteBarrier((&____cubicBezierDecoder_2), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // PATH_T3614338981_H
- #ifndef TEXTASSET_T3022178571_H
- #define TEXTASSET_T3022178571_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.TextAsset
- struct TextAsset_t3022178571 : public Object_t631007953
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TEXTASSET_T3022178571_H
- #ifndef MULTICASTDELEGATE_T_H
- #define MULTICASTDELEGATE_T_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // System.MulticastDelegate
- struct MulticastDelegate_t : public Delegate_t1188392813
- {
- public:
- // System.MulticastDelegate System.MulticastDelegate::prev
- MulticastDelegate_t * ___prev_9;
- // System.MulticastDelegate System.MulticastDelegate::kpm_next
- MulticastDelegate_t * ___kpm_next_10;
- public:
- inline static int32_t get_offset_of_prev_9() { return static_cast<int32_t>(offsetof(MulticastDelegate_t, ___prev_9)); }
- inline MulticastDelegate_t * get_prev_9() const { return ___prev_9; }
- inline MulticastDelegate_t ** get_address_of_prev_9() { return &___prev_9; }
- inline void set_prev_9(MulticastDelegate_t * value)
- {
- ___prev_9 = value;
- Il2CppCodeGenWriteBarrier((&___prev_9), value);
- }
- inline static int32_t get_offset_of_kpm_next_10() { return static_cast<int32_t>(offsetof(MulticastDelegate_t, ___kpm_next_10)); }
- inline MulticastDelegate_t * get_kpm_next_10() const { return ___kpm_next_10; }
- inline MulticastDelegate_t ** get_address_of_kpm_next_10() { return &___kpm_next_10; }
- inline void set_kpm_next_10(MulticastDelegate_t * value)
- {
- ___kpm_next_10 = value;
- Il2CppCodeGenWriteBarrier((&___kpm_next_10), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // MULTICASTDELEGATE_T_H
- #ifndef MESH_T3648964284_H
- #define MESH_T3648964284_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Mesh
- struct Mesh_t3648964284 : public Object_t631007953
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // MESH_T3648964284_H
- #ifndef RENDERER_T2627027031_H
- #define RENDERER_T2627027031_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Renderer
- struct Renderer_t2627027031 : public Component_t1923634451
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // RENDERER_T2627027031_H
- #ifndef LUA_CSFUNCTION_T883524059_H
- #define LUA_CSFUNCTION_T883524059_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // XLua.LuaDLL.lua_CSFunction
- struct lua_CSFunction_t883524059 : public MulticastDelegate_t
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // LUA_CSFUNCTION_T883524059_H
- #ifndef TRANSFORM_T3600365921_H
- #define TRANSFORM_T3600365921_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.Transform
- struct Transform_t3600365921 : public Component_t1923634451
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TRANSFORM_T3600365921_H
- #ifndef TWEEN_T2342918553_H
- #define TWEEN_T2342918553_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Tween
- struct Tween_t2342918553 : public ABSSequentiable_t3376041011
- {
- public:
- // System.Single DG.Tweening.Tween::timeScale
- float ___timeScale_4;
- // System.Boolean DG.Tweening.Tween::isBackwards
- bool ___isBackwards_5;
- // System.Object DG.Tweening.Tween::id
- RuntimeObject * ___id_6;
- // System.String DG.Tweening.Tween::stringId
- String_t* ___stringId_7;
- // System.Int32 DG.Tweening.Tween::intId
- int32_t ___intId_8;
- // System.Object DG.Tweening.Tween::target
- RuntimeObject * ___target_9;
- // DG.Tweening.UpdateType DG.Tweening.Tween::updateType
- int32_t ___updateType_10;
- // System.Boolean DG.Tweening.Tween::isIndependentUpdate
- bool ___isIndependentUpdate_11;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onPlay
- TweenCallback_t3727756325 * ___onPlay_12;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onPause
- TweenCallback_t3727756325 * ___onPause_13;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onRewind
- TweenCallback_t3727756325 * ___onRewind_14;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onUpdate
- TweenCallback_t3727756325 * ___onUpdate_15;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onStepComplete
- TweenCallback_t3727756325 * ___onStepComplete_16;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onComplete
- TweenCallback_t3727756325 * ___onComplete_17;
- // DG.Tweening.TweenCallback DG.Tweening.Tween::onKill
- TweenCallback_t3727756325 * ___onKill_18;
- // DG.Tweening.TweenCallback`1<System.Int32> DG.Tweening.Tween::onWaypointChange
- TweenCallback_1_t3009965658 * ___onWaypointChange_19;
- // System.Boolean DG.Tweening.Tween::isFrom
- bool ___isFrom_20;
- // System.Boolean DG.Tweening.Tween::isBlendable
- bool ___isBlendable_21;
- // System.Boolean DG.Tweening.Tween::isRecyclable
- bool ___isRecyclable_22;
- // System.Boolean DG.Tweening.Tween::isSpeedBased
- bool ___isSpeedBased_23;
- // System.Boolean DG.Tweening.Tween::autoKill
- bool ___autoKill_24;
- // System.Single DG.Tweening.Tween::duration
- float ___duration_25;
- // System.Int32 DG.Tweening.Tween::loops
- int32_t ___loops_26;
- // DG.Tweening.LoopType DG.Tweening.Tween::loopType
- int32_t ___loopType_27;
- // System.Single DG.Tweening.Tween::delay
- float ___delay_28;
- // System.Boolean DG.Tweening.Tween::<isRelative>k__BackingField
- bool ___U3CisRelativeU3Ek__BackingField_29;
- // DG.Tweening.Ease DG.Tweening.Tween::easeType
- int32_t ___easeType_30;
- // DG.Tweening.EaseFunction DG.Tweening.Tween::customEase
- EaseFunction_t3531141372 * ___customEase_31;
- // System.Single DG.Tweening.Tween::easeOvershootOrAmplitude
- float ___easeOvershootOrAmplitude_32;
- // System.Single DG.Tweening.Tween::easePeriod
- float ___easePeriod_33;
- // System.Type DG.Tweening.Tween::typeofT1
- Type_t * ___typeofT1_34;
- // System.Type DG.Tweening.Tween::typeofT2
- Type_t * ___typeofT2_35;
- // System.Type DG.Tweening.Tween::typeofTPlugOptions
- Type_t * ___typeofTPlugOptions_36;
- // System.Boolean DG.Tweening.Tween::<active>k__BackingField
- bool ___U3CactiveU3Ek__BackingField_37;
- // System.Boolean DG.Tweening.Tween::isSequenced
- bool ___isSequenced_38;
- // DG.Tweening.Sequence DG.Tweening.Tween::sequenceParent
- Sequence_t2050373119 * ___sequenceParent_39;
- // System.Int32 DG.Tweening.Tween::activeId
- int32_t ___activeId_40;
- // DG.Tweening.Core.Enums.SpecialStartupMode DG.Tweening.Tween::specialStartupMode
- int32_t ___specialStartupMode_41;
- // System.Boolean DG.Tweening.Tween::creationLocked
- bool ___creationLocked_42;
- // System.Boolean DG.Tweening.Tween::startupDone
- bool ___startupDone_43;
- // System.Boolean DG.Tweening.Tween::<playedOnce>k__BackingField
- bool ___U3CplayedOnceU3Ek__BackingField_44;
- // System.Single DG.Tweening.Tween::<position>k__BackingField
- float ___U3CpositionU3Ek__BackingField_45;
- // System.Single DG.Tweening.Tween::fullDuration
- float ___fullDuration_46;
- // System.Int32 DG.Tweening.Tween::completedLoops
- int32_t ___completedLoops_47;
- // System.Boolean DG.Tweening.Tween::isPlaying
- bool ___isPlaying_48;
- // System.Boolean DG.Tweening.Tween::isComplete
- bool ___isComplete_49;
- // System.Single DG.Tweening.Tween::elapsedDelay
- float ___elapsedDelay_50;
- // System.Boolean DG.Tweening.Tween::delayComplete
- bool ___delayComplete_51;
- // System.Int32 DG.Tweening.Tween::miscInt
- int32_t ___miscInt_52;
- public:
- inline static int32_t get_offset_of_timeScale_4() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___timeScale_4)); }
- inline float get_timeScale_4() const { return ___timeScale_4; }
- inline float* get_address_of_timeScale_4() { return &___timeScale_4; }
- inline void set_timeScale_4(float value)
- {
- ___timeScale_4 = value;
- }
- inline static int32_t get_offset_of_isBackwards_5() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isBackwards_5)); }
- inline bool get_isBackwards_5() const { return ___isBackwards_5; }
- inline bool* get_address_of_isBackwards_5() { return &___isBackwards_5; }
- inline void set_isBackwards_5(bool value)
- {
- ___isBackwards_5 = value;
- }
- inline static int32_t get_offset_of_id_6() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___id_6)); }
- inline RuntimeObject * get_id_6() const { return ___id_6; }
- inline RuntimeObject ** get_address_of_id_6() { return &___id_6; }
- inline void set_id_6(RuntimeObject * value)
- {
- ___id_6 = value;
- Il2CppCodeGenWriteBarrier((&___id_6), value);
- }
- inline static int32_t get_offset_of_stringId_7() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___stringId_7)); }
- inline String_t* get_stringId_7() const { return ___stringId_7; }
- inline String_t** get_address_of_stringId_7() { return &___stringId_7; }
- inline void set_stringId_7(String_t* value)
- {
- ___stringId_7 = value;
- Il2CppCodeGenWriteBarrier((&___stringId_7), value);
- }
- inline static int32_t get_offset_of_intId_8() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___intId_8)); }
- inline int32_t get_intId_8() const { return ___intId_8; }
- inline int32_t* get_address_of_intId_8() { return &___intId_8; }
- inline void set_intId_8(int32_t value)
- {
- ___intId_8 = value;
- }
- inline static int32_t get_offset_of_target_9() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___target_9)); }
- inline RuntimeObject * get_target_9() const { return ___target_9; }
- inline RuntimeObject ** get_address_of_target_9() { return &___target_9; }
- inline void set_target_9(RuntimeObject * value)
- {
- ___target_9 = value;
- Il2CppCodeGenWriteBarrier((&___target_9), value);
- }
- inline static int32_t get_offset_of_updateType_10() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___updateType_10)); }
- inline int32_t get_updateType_10() const { return ___updateType_10; }
- inline int32_t* get_address_of_updateType_10() { return &___updateType_10; }
- inline void set_updateType_10(int32_t value)
- {
- ___updateType_10 = value;
- }
- inline static int32_t get_offset_of_isIndependentUpdate_11() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isIndependentUpdate_11)); }
- inline bool get_isIndependentUpdate_11() const { return ___isIndependentUpdate_11; }
- inline bool* get_address_of_isIndependentUpdate_11() { return &___isIndependentUpdate_11; }
- inline void set_isIndependentUpdate_11(bool value)
- {
- ___isIndependentUpdate_11 = value;
- }
- inline static int32_t get_offset_of_onPlay_12() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onPlay_12)); }
- inline TweenCallback_t3727756325 * get_onPlay_12() const { return ___onPlay_12; }
- inline TweenCallback_t3727756325 ** get_address_of_onPlay_12() { return &___onPlay_12; }
- inline void set_onPlay_12(TweenCallback_t3727756325 * value)
- {
- ___onPlay_12 = value;
- Il2CppCodeGenWriteBarrier((&___onPlay_12), value);
- }
- inline static int32_t get_offset_of_onPause_13() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onPause_13)); }
- inline TweenCallback_t3727756325 * get_onPause_13() const { return ___onPause_13; }
- inline TweenCallback_t3727756325 ** get_address_of_onPause_13() { return &___onPause_13; }
- inline void set_onPause_13(TweenCallback_t3727756325 * value)
- {
- ___onPause_13 = value;
- Il2CppCodeGenWriteBarrier((&___onPause_13), value);
- }
- inline static int32_t get_offset_of_onRewind_14() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onRewind_14)); }
- inline TweenCallback_t3727756325 * get_onRewind_14() const { return ___onRewind_14; }
- inline TweenCallback_t3727756325 ** get_address_of_onRewind_14() { return &___onRewind_14; }
- inline void set_onRewind_14(TweenCallback_t3727756325 * value)
- {
- ___onRewind_14 = value;
- Il2CppCodeGenWriteBarrier((&___onRewind_14), value);
- }
- inline static int32_t get_offset_of_onUpdate_15() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onUpdate_15)); }
- inline TweenCallback_t3727756325 * get_onUpdate_15() const { return ___onUpdate_15; }
- inline TweenCallback_t3727756325 ** get_address_of_onUpdate_15() { return &___onUpdate_15; }
- inline void set_onUpdate_15(TweenCallback_t3727756325 * value)
- {
- ___onUpdate_15 = value;
- Il2CppCodeGenWriteBarrier((&___onUpdate_15), value);
- }
- inline static int32_t get_offset_of_onStepComplete_16() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onStepComplete_16)); }
- inline TweenCallback_t3727756325 * get_onStepComplete_16() const { return ___onStepComplete_16; }
- inline TweenCallback_t3727756325 ** get_address_of_onStepComplete_16() { return &___onStepComplete_16; }
- inline void set_onStepComplete_16(TweenCallback_t3727756325 * value)
- {
- ___onStepComplete_16 = value;
- Il2CppCodeGenWriteBarrier((&___onStepComplete_16), value);
- }
- inline static int32_t get_offset_of_onComplete_17() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onComplete_17)); }
- inline TweenCallback_t3727756325 * get_onComplete_17() const { return ___onComplete_17; }
- inline TweenCallback_t3727756325 ** get_address_of_onComplete_17() { return &___onComplete_17; }
- inline void set_onComplete_17(TweenCallback_t3727756325 * value)
- {
- ___onComplete_17 = value;
- Il2CppCodeGenWriteBarrier((&___onComplete_17), value);
- }
- inline static int32_t get_offset_of_onKill_18() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onKill_18)); }
- inline TweenCallback_t3727756325 * get_onKill_18() const { return ___onKill_18; }
- inline TweenCallback_t3727756325 ** get_address_of_onKill_18() { return &___onKill_18; }
- inline void set_onKill_18(TweenCallback_t3727756325 * value)
- {
- ___onKill_18 = value;
- Il2CppCodeGenWriteBarrier((&___onKill_18), value);
- }
- inline static int32_t get_offset_of_onWaypointChange_19() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___onWaypointChange_19)); }
- inline TweenCallback_1_t3009965658 * get_onWaypointChange_19() const { return ___onWaypointChange_19; }
- inline TweenCallback_1_t3009965658 ** get_address_of_onWaypointChange_19() { return &___onWaypointChange_19; }
- inline void set_onWaypointChange_19(TweenCallback_1_t3009965658 * value)
- {
- ___onWaypointChange_19 = value;
- Il2CppCodeGenWriteBarrier((&___onWaypointChange_19), value);
- }
- inline static int32_t get_offset_of_isFrom_20() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isFrom_20)); }
- inline bool get_isFrom_20() const { return ___isFrom_20; }
- inline bool* get_address_of_isFrom_20() { return &___isFrom_20; }
- inline void set_isFrom_20(bool value)
- {
- ___isFrom_20 = value;
- }
- inline static int32_t get_offset_of_isBlendable_21() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isBlendable_21)); }
- inline bool get_isBlendable_21() const { return ___isBlendable_21; }
- inline bool* get_address_of_isBlendable_21() { return &___isBlendable_21; }
- inline void set_isBlendable_21(bool value)
- {
- ___isBlendable_21 = value;
- }
- inline static int32_t get_offset_of_isRecyclable_22() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isRecyclable_22)); }
- inline bool get_isRecyclable_22() const { return ___isRecyclable_22; }
- inline bool* get_address_of_isRecyclable_22() { return &___isRecyclable_22; }
- inline void set_isRecyclable_22(bool value)
- {
- ___isRecyclable_22 = value;
- }
- inline static int32_t get_offset_of_isSpeedBased_23() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isSpeedBased_23)); }
- inline bool get_isSpeedBased_23() const { return ___isSpeedBased_23; }
- inline bool* get_address_of_isSpeedBased_23() { return &___isSpeedBased_23; }
- inline void set_isSpeedBased_23(bool value)
- {
- ___isSpeedBased_23 = value;
- }
- inline static int32_t get_offset_of_autoKill_24() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___autoKill_24)); }
- inline bool get_autoKill_24() const { return ___autoKill_24; }
- inline bool* get_address_of_autoKill_24() { return &___autoKill_24; }
- inline void set_autoKill_24(bool value)
- {
- ___autoKill_24 = value;
- }
- inline static int32_t get_offset_of_duration_25() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___duration_25)); }
- inline float get_duration_25() const { return ___duration_25; }
- inline float* get_address_of_duration_25() { return &___duration_25; }
- inline void set_duration_25(float value)
- {
- ___duration_25 = value;
- }
- inline static int32_t get_offset_of_loops_26() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___loops_26)); }
- inline int32_t get_loops_26() const { return ___loops_26; }
- inline int32_t* get_address_of_loops_26() { return &___loops_26; }
- inline void set_loops_26(int32_t value)
- {
- ___loops_26 = value;
- }
- inline static int32_t get_offset_of_loopType_27() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___loopType_27)); }
- inline int32_t get_loopType_27() const { return ___loopType_27; }
- inline int32_t* get_address_of_loopType_27() { return &___loopType_27; }
- inline void set_loopType_27(int32_t value)
- {
- ___loopType_27 = value;
- }
- inline static int32_t get_offset_of_delay_28() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___delay_28)); }
- inline float get_delay_28() const { return ___delay_28; }
- inline float* get_address_of_delay_28() { return &___delay_28; }
- inline void set_delay_28(float value)
- {
- ___delay_28 = value;
- }
- inline static int32_t get_offset_of_U3CisRelativeU3Ek__BackingField_29() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___U3CisRelativeU3Ek__BackingField_29)); }
- inline bool get_U3CisRelativeU3Ek__BackingField_29() const { return ___U3CisRelativeU3Ek__BackingField_29; }
- inline bool* get_address_of_U3CisRelativeU3Ek__BackingField_29() { return &___U3CisRelativeU3Ek__BackingField_29; }
- inline void set_U3CisRelativeU3Ek__BackingField_29(bool value)
- {
- ___U3CisRelativeU3Ek__BackingField_29 = value;
- }
- inline static int32_t get_offset_of_easeType_30() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___easeType_30)); }
- inline int32_t get_easeType_30() const { return ___easeType_30; }
- inline int32_t* get_address_of_easeType_30() { return &___easeType_30; }
- inline void set_easeType_30(int32_t value)
- {
- ___easeType_30 = value;
- }
- inline static int32_t get_offset_of_customEase_31() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___customEase_31)); }
- inline EaseFunction_t3531141372 * get_customEase_31() const { return ___customEase_31; }
- inline EaseFunction_t3531141372 ** get_address_of_customEase_31() { return &___customEase_31; }
- inline void set_customEase_31(EaseFunction_t3531141372 * value)
- {
- ___customEase_31 = value;
- Il2CppCodeGenWriteBarrier((&___customEase_31), value);
- }
- inline static int32_t get_offset_of_easeOvershootOrAmplitude_32() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___easeOvershootOrAmplitude_32)); }
- inline float get_easeOvershootOrAmplitude_32() const { return ___easeOvershootOrAmplitude_32; }
- inline float* get_address_of_easeOvershootOrAmplitude_32() { return &___easeOvershootOrAmplitude_32; }
- inline void set_easeOvershootOrAmplitude_32(float value)
- {
- ___easeOvershootOrAmplitude_32 = value;
- }
- inline static int32_t get_offset_of_easePeriod_33() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___easePeriod_33)); }
- inline float get_easePeriod_33() const { return ___easePeriod_33; }
- inline float* get_address_of_easePeriod_33() { return &___easePeriod_33; }
- inline void set_easePeriod_33(float value)
- {
- ___easePeriod_33 = value;
- }
- inline static int32_t get_offset_of_typeofT1_34() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___typeofT1_34)); }
- inline Type_t * get_typeofT1_34() const { return ___typeofT1_34; }
- inline Type_t ** get_address_of_typeofT1_34() { return &___typeofT1_34; }
- inline void set_typeofT1_34(Type_t * value)
- {
- ___typeofT1_34 = value;
- Il2CppCodeGenWriteBarrier((&___typeofT1_34), value);
- }
- inline static int32_t get_offset_of_typeofT2_35() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___typeofT2_35)); }
- inline Type_t * get_typeofT2_35() const { return ___typeofT2_35; }
- inline Type_t ** get_address_of_typeofT2_35() { return &___typeofT2_35; }
- inline void set_typeofT2_35(Type_t * value)
- {
- ___typeofT2_35 = value;
- Il2CppCodeGenWriteBarrier((&___typeofT2_35), value);
- }
- inline static int32_t get_offset_of_typeofTPlugOptions_36() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___typeofTPlugOptions_36)); }
- inline Type_t * get_typeofTPlugOptions_36() const { return ___typeofTPlugOptions_36; }
- inline Type_t ** get_address_of_typeofTPlugOptions_36() { return &___typeofTPlugOptions_36; }
- inline void set_typeofTPlugOptions_36(Type_t * value)
- {
- ___typeofTPlugOptions_36 = value;
- Il2CppCodeGenWriteBarrier((&___typeofTPlugOptions_36), value);
- }
- inline static int32_t get_offset_of_U3CactiveU3Ek__BackingField_37() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___U3CactiveU3Ek__BackingField_37)); }
- inline bool get_U3CactiveU3Ek__BackingField_37() const { return ___U3CactiveU3Ek__BackingField_37; }
- inline bool* get_address_of_U3CactiveU3Ek__BackingField_37() { return &___U3CactiveU3Ek__BackingField_37; }
- inline void set_U3CactiveU3Ek__BackingField_37(bool value)
- {
- ___U3CactiveU3Ek__BackingField_37 = value;
- }
- inline static int32_t get_offset_of_isSequenced_38() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isSequenced_38)); }
- inline bool get_isSequenced_38() const { return ___isSequenced_38; }
- inline bool* get_address_of_isSequenced_38() { return &___isSequenced_38; }
- inline void set_isSequenced_38(bool value)
- {
- ___isSequenced_38 = value;
- }
- inline static int32_t get_offset_of_sequenceParent_39() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___sequenceParent_39)); }
- inline Sequence_t2050373119 * get_sequenceParent_39() const { return ___sequenceParent_39; }
- inline Sequence_t2050373119 ** get_address_of_sequenceParent_39() { return &___sequenceParent_39; }
- inline void set_sequenceParent_39(Sequence_t2050373119 * value)
- {
- ___sequenceParent_39 = value;
- Il2CppCodeGenWriteBarrier((&___sequenceParent_39), value);
- }
- inline static int32_t get_offset_of_activeId_40() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___activeId_40)); }
- inline int32_t get_activeId_40() const { return ___activeId_40; }
- inline int32_t* get_address_of_activeId_40() { return &___activeId_40; }
- inline void set_activeId_40(int32_t value)
- {
- ___activeId_40 = value;
- }
- inline static int32_t get_offset_of_specialStartupMode_41() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___specialStartupMode_41)); }
- inline int32_t get_specialStartupMode_41() const { return ___specialStartupMode_41; }
- inline int32_t* get_address_of_specialStartupMode_41() { return &___specialStartupMode_41; }
- inline void set_specialStartupMode_41(int32_t value)
- {
- ___specialStartupMode_41 = value;
- }
- inline static int32_t get_offset_of_creationLocked_42() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___creationLocked_42)); }
- inline bool get_creationLocked_42() const { return ___creationLocked_42; }
- inline bool* get_address_of_creationLocked_42() { return &___creationLocked_42; }
- inline void set_creationLocked_42(bool value)
- {
- ___creationLocked_42 = value;
- }
- inline static int32_t get_offset_of_startupDone_43() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___startupDone_43)); }
- inline bool get_startupDone_43() const { return ___startupDone_43; }
- inline bool* get_address_of_startupDone_43() { return &___startupDone_43; }
- inline void set_startupDone_43(bool value)
- {
- ___startupDone_43 = value;
- }
- inline static int32_t get_offset_of_U3CplayedOnceU3Ek__BackingField_44() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___U3CplayedOnceU3Ek__BackingField_44)); }
- inline bool get_U3CplayedOnceU3Ek__BackingField_44() const { return ___U3CplayedOnceU3Ek__BackingField_44; }
- inline bool* get_address_of_U3CplayedOnceU3Ek__BackingField_44() { return &___U3CplayedOnceU3Ek__BackingField_44; }
- inline void set_U3CplayedOnceU3Ek__BackingField_44(bool value)
- {
- ___U3CplayedOnceU3Ek__BackingField_44 = value;
- }
- inline static int32_t get_offset_of_U3CpositionU3Ek__BackingField_45() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___U3CpositionU3Ek__BackingField_45)); }
- inline float get_U3CpositionU3Ek__BackingField_45() const { return ___U3CpositionU3Ek__BackingField_45; }
- inline float* get_address_of_U3CpositionU3Ek__BackingField_45() { return &___U3CpositionU3Ek__BackingField_45; }
- inline void set_U3CpositionU3Ek__BackingField_45(float value)
- {
- ___U3CpositionU3Ek__BackingField_45 = value;
- }
- inline static int32_t get_offset_of_fullDuration_46() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___fullDuration_46)); }
- inline float get_fullDuration_46() const { return ___fullDuration_46; }
- inline float* get_address_of_fullDuration_46() { return &___fullDuration_46; }
- inline void set_fullDuration_46(float value)
- {
- ___fullDuration_46 = value;
- }
- inline static int32_t get_offset_of_completedLoops_47() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___completedLoops_47)); }
- inline int32_t get_completedLoops_47() const { return ___completedLoops_47; }
- inline int32_t* get_address_of_completedLoops_47() { return &___completedLoops_47; }
- inline void set_completedLoops_47(int32_t value)
- {
- ___completedLoops_47 = value;
- }
- inline static int32_t get_offset_of_isPlaying_48() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isPlaying_48)); }
- inline bool get_isPlaying_48() const { return ___isPlaying_48; }
- inline bool* get_address_of_isPlaying_48() { return &___isPlaying_48; }
- inline void set_isPlaying_48(bool value)
- {
- ___isPlaying_48 = value;
- }
- inline static int32_t get_offset_of_isComplete_49() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___isComplete_49)); }
- inline bool get_isComplete_49() const { return ___isComplete_49; }
- inline bool* get_address_of_isComplete_49() { return &___isComplete_49; }
- inline void set_isComplete_49(bool value)
- {
- ___isComplete_49 = value;
- }
- inline static int32_t get_offset_of_elapsedDelay_50() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___elapsedDelay_50)); }
- inline float get_elapsedDelay_50() const { return ___elapsedDelay_50; }
- inline float* get_address_of_elapsedDelay_50() { return &___elapsedDelay_50; }
- inline void set_elapsedDelay_50(float value)
- {
- ___elapsedDelay_50 = value;
- }
- inline static int32_t get_offset_of_delayComplete_51() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___delayComplete_51)); }
- inline bool get_delayComplete_51() const { return ___delayComplete_51; }
- inline bool* get_address_of_delayComplete_51() { return &___delayComplete_51; }
- inline void set_delayComplete_51(bool value)
- {
- ___delayComplete_51 = value;
- }
- inline static int32_t get_offset_of_miscInt_52() { return static_cast<int32_t>(offsetof(Tween_t2342918553, ___miscInt_52)); }
- inline int32_t get_miscInt_52() const { return ___miscInt_52; }
- inline int32_t* get_address_of_miscInt_52() { return &___miscInt_52; }
- inline void set_miscInt_52(int32_t value)
- {
- ___miscInt_52 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEEN_T2342918553_H
- #ifndef TWEENER_T436044680_H
- #define TWEENER_T436044680_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Tweener
- struct Tweener_t436044680 : public Tween_t2342918553
- {
- public:
- // System.Boolean DG.Tweening.Tweener::hasManuallySetStartValue
- bool ___hasManuallySetStartValue_53;
- // System.Boolean DG.Tweening.Tweener::isFromAllowed
- bool ___isFromAllowed_54;
- public:
- inline static int32_t get_offset_of_hasManuallySetStartValue_53() { return static_cast<int32_t>(offsetof(Tweener_t436044680, ___hasManuallySetStartValue_53)); }
- inline bool get_hasManuallySetStartValue_53() const { return ___hasManuallySetStartValue_53; }
- inline bool* get_address_of_hasManuallySetStartValue_53() { return &___hasManuallySetStartValue_53; }
- inline void set_hasManuallySetStartValue_53(bool value)
- {
- ___hasManuallySetStartValue_53 = value;
- }
- inline static int32_t get_offset_of_isFromAllowed_54() { return static_cast<int32_t>(offsetof(Tweener_t436044680, ___isFromAllowed_54)); }
- inline bool get_isFromAllowed_54() const { return ___isFromAllowed_54; }
- inline bool* get_address_of_isFromAllowed_54() { return &___isFromAllowed_54; }
- inline void set_isFromAllowed_54(bool value)
- {
- ___isFromAllowed_54 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEENER_T436044680_H
- #ifndef SEQUENCE_T2050373119_H
- #define SEQUENCE_T2050373119_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Sequence
- struct Sequence_t2050373119 : public Tween_t2342918553
- {
- public:
- // System.Collections.Generic.List`1<DG.Tweening.Tween> DG.Tweening.Sequence::sequencedTweens
- List_1_t3814993295 * ___sequencedTweens_53;
- // System.Collections.Generic.List`1<DG.Tweening.Core.ABSSequentiable> DG.Tweening.Sequence::_sequencedObjs
- List_1_t553148457 * ____sequencedObjs_54;
- // System.Single DG.Tweening.Sequence::lastTweenInsertTime
- float ___lastTweenInsertTime_55;
- public:
- inline static int32_t get_offset_of_sequencedTweens_53() { return static_cast<int32_t>(offsetof(Sequence_t2050373119, ___sequencedTweens_53)); }
- inline List_1_t3814993295 * get_sequencedTweens_53() const { return ___sequencedTweens_53; }
- inline List_1_t3814993295 ** get_address_of_sequencedTweens_53() { return &___sequencedTweens_53; }
- inline void set_sequencedTweens_53(List_1_t3814993295 * value)
- {
- ___sequencedTweens_53 = value;
- Il2CppCodeGenWriteBarrier((&___sequencedTweens_53), value);
- }
- inline static int32_t get_offset_of__sequencedObjs_54() { return static_cast<int32_t>(offsetof(Sequence_t2050373119, ____sequencedObjs_54)); }
- inline List_1_t553148457 * get__sequencedObjs_54() const { return ____sequencedObjs_54; }
- inline List_1_t553148457 ** get_address_of__sequencedObjs_54() { return &____sequencedObjs_54; }
- inline void set__sequencedObjs_54(List_1_t553148457 * value)
- {
- ____sequencedObjs_54 = value;
- Il2CppCodeGenWriteBarrier((&____sequencedObjs_54), value);
- }
- inline static int32_t get_offset_of_lastTweenInsertTime_55() { return static_cast<int32_t>(offsetof(Sequence_t2050373119, ___lastTweenInsertTime_55)); }
- inline float get_lastTweenInsertTime_55() const { return ___lastTweenInsertTime_55; }
- inline float* get_address_of_lastTweenInsertTime_55() { return &___lastTweenInsertTime_55; }
- inline void set_lastTweenInsertTime_55(float value)
- {
- ___lastTweenInsertTime_55 = value;
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // SEQUENCE_T2050373119_H
- #ifndef SKINNEDMESHRENDERER_T245602842_H
- #define SKINNEDMESHRENDERER_T245602842_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // UnityEngine.SkinnedMeshRenderer
- struct SkinnedMeshRenderer_t245602842 : public Renderer_t2627027031
- {
- public:
- public:
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // SKINNEDMESHRENDERER_T245602842_H
- #ifndef TWEENERCORE_3_T3785815898_H
- #define TWEENERCORE_3_T3785815898_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Quaternion,DG.Tweening.Plugins.Options.NoOptions>
- struct TweenerCore_3_t3785815898 : public Tweener_t436044680
- {
- public:
- // T2 DG.Tweening.Core.TweenerCore`3::startValue
- Quaternion_t2301928331 ___startValue_55;
- // T2 DG.Tweening.Core.TweenerCore`3::endValue
- Quaternion_t2301928331 ___endValue_56;
- // T2 DG.Tweening.Core.TweenerCore`3::changeValue
- Quaternion_t2301928331 ___changeValue_57;
- // TPlugOptions DG.Tweening.Core.TweenerCore`3::plugOptions
- NoOptions_t313102519 ___plugOptions_58;
- // DG.Tweening.Core.DOGetter`1<T1> DG.Tweening.Core.TweenerCore`3::getter
- DOGetter_1_t2044724535 * ___getter_59;
- // DG.Tweening.Core.DOSetter`1<T1> DG.Tweening.Core.TweenerCore`3::setter
- DOSetter_1_t3352036663 * ___setter_60;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<T1,T2,TPlugOptions> DG.Tweening.Core.TweenerCore`3::tweenPlugin
- ABSTweenPlugin_3_t3321825548 * ___tweenPlugin_61;
- public:
- inline static int32_t get_offset_of_startValue_55() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___startValue_55)); }
- inline Quaternion_t2301928331 get_startValue_55() const { return ___startValue_55; }
- inline Quaternion_t2301928331 * get_address_of_startValue_55() { return &___startValue_55; }
- inline void set_startValue_55(Quaternion_t2301928331 value)
- {
- ___startValue_55 = value;
- }
- inline static int32_t get_offset_of_endValue_56() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___endValue_56)); }
- inline Quaternion_t2301928331 get_endValue_56() const { return ___endValue_56; }
- inline Quaternion_t2301928331 * get_address_of_endValue_56() { return &___endValue_56; }
- inline void set_endValue_56(Quaternion_t2301928331 value)
- {
- ___endValue_56 = value;
- }
- inline static int32_t get_offset_of_changeValue_57() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___changeValue_57)); }
- inline Quaternion_t2301928331 get_changeValue_57() const { return ___changeValue_57; }
- inline Quaternion_t2301928331 * get_address_of_changeValue_57() { return &___changeValue_57; }
- inline void set_changeValue_57(Quaternion_t2301928331 value)
- {
- ___changeValue_57 = value;
- }
- inline static int32_t get_offset_of_plugOptions_58() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___plugOptions_58)); }
- inline NoOptions_t313102519 get_plugOptions_58() const { return ___plugOptions_58; }
- inline NoOptions_t313102519 * get_address_of_plugOptions_58() { return &___plugOptions_58; }
- inline void set_plugOptions_58(NoOptions_t313102519 value)
- {
- ___plugOptions_58 = value;
- }
- inline static int32_t get_offset_of_getter_59() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___getter_59)); }
- inline DOGetter_1_t2044724535 * get_getter_59() const { return ___getter_59; }
- inline DOGetter_1_t2044724535 ** get_address_of_getter_59() { return &___getter_59; }
- inline void set_getter_59(DOGetter_1_t2044724535 * value)
- {
- ___getter_59 = value;
- Il2CppCodeGenWriteBarrier((&___getter_59), value);
- }
- inline static int32_t get_offset_of_setter_60() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___setter_60)); }
- inline DOSetter_1_t3352036663 * get_setter_60() const { return ___setter_60; }
- inline DOSetter_1_t3352036663 ** get_address_of_setter_60() { return &___setter_60; }
- inline void set_setter_60(DOSetter_1_t3352036663 * value)
- {
- ___setter_60 = value;
- Il2CppCodeGenWriteBarrier((&___setter_60), value);
- }
- inline static int32_t get_offset_of_tweenPlugin_61() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3785815898, ___tweenPlugin_61)); }
- inline ABSTweenPlugin_3_t3321825548 * get_tweenPlugin_61() const { return ___tweenPlugin_61; }
- inline ABSTweenPlugin_3_t3321825548 ** get_address_of_tweenPlugin_61() { return &___tweenPlugin_61; }
- inline void set_tweenPlugin_61(ABSTweenPlugin_3_t3321825548 * value)
- {
- ___tweenPlugin_61 = value;
- Il2CppCodeGenWriteBarrier((&___tweenPlugin_61), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEENERCORE_3_T3785815898_H
- #ifndef TWEENERCORE_3_T1299559007_H
- #define TWEENERCORE_3_T1299559007_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Vector3,DG.Tweening.Plugins.Options.QuaternionOptions>
- struct TweenerCore_3_t1299559007 : public Tweener_t436044680
- {
- public:
- // T2 DG.Tweening.Core.TweenerCore`3::startValue
- Vector3_t3722313464 ___startValue_55;
- // T2 DG.Tweening.Core.TweenerCore`3::endValue
- Vector3_t3722313464 ___endValue_56;
- // T2 DG.Tweening.Core.TweenerCore`3::changeValue
- Vector3_t3722313464 ___changeValue_57;
- // TPlugOptions DG.Tweening.Core.TweenerCore`3::plugOptions
- QuaternionOptions_t2974423933 ___plugOptions_58;
- // DG.Tweening.Core.DOGetter`1<T1> DG.Tweening.Core.TweenerCore`3::getter
- DOGetter_1_t2044724535 * ___getter_59;
- // DG.Tweening.Core.DOSetter`1<T1> DG.Tweening.Core.TweenerCore`3::setter
- DOSetter_1_t3352036663 * ___setter_60;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<T1,T2,TPlugOptions> DG.Tweening.Core.TweenerCore`3::tweenPlugin
- ABSTweenPlugin_3_t835568657 * ___tweenPlugin_61;
- public:
- inline static int32_t get_offset_of_startValue_55() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___startValue_55)); }
- inline Vector3_t3722313464 get_startValue_55() const { return ___startValue_55; }
- inline Vector3_t3722313464 * get_address_of_startValue_55() { return &___startValue_55; }
- inline void set_startValue_55(Vector3_t3722313464 value)
- {
- ___startValue_55 = value;
- }
- inline static int32_t get_offset_of_endValue_56() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___endValue_56)); }
- inline Vector3_t3722313464 get_endValue_56() const { return ___endValue_56; }
- inline Vector3_t3722313464 * get_address_of_endValue_56() { return &___endValue_56; }
- inline void set_endValue_56(Vector3_t3722313464 value)
- {
- ___endValue_56 = value;
- }
- inline static int32_t get_offset_of_changeValue_57() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___changeValue_57)); }
- inline Vector3_t3722313464 get_changeValue_57() const { return ___changeValue_57; }
- inline Vector3_t3722313464 * get_address_of_changeValue_57() { return &___changeValue_57; }
- inline void set_changeValue_57(Vector3_t3722313464 value)
- {
- ___changeValue_57 = value;
- }
- inline static int32_t get_offset_of_plugOptions_58() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___plugOptions_58)); }
- inline QuaternionOptions_t2974423933 get_plugOptions_58() const { return ___plugOptions_58; }
- inline QuaternionOptions_t2974423933 * get_address_of_plugOptions_58() { return &___plugOptions_58; }
- inline void set_plugOptions_58(QuaternionOptions_t2974423933 value)
- {
- ___plugOptions_58 = value;
- }
- inline static int32_t get_offset_of_getter_59() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___getter_59)); }
- inline DOGetter_1_t2044724535 * get_getter_59() const { return ___getter_59; }
- inline DOGetter_1_t2044724535 ** get_address_of_getter_59() { return &___getter_59; }
- inline void set_getter_59(DOGetter_1_t2044724535 * value)
- {
- ___getter_59 = value;
- Il2CppCodeGenWriteBarrier((&___getter_59), value);
- }
- inline static int32_t get_offset_of_setter_60() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___setter_60)); }
- inline DOSetter_1_t3352036663 * get_setter_60() const { return ___setter_60; }
- inline DOSetter_1_t3352036663 ** get_address_of_setter_60() { return &___setter_60; }
- inline void set_setter_60(DOSetter_1_t3352036663 * value)
- {
- ___setter_60 = value;
- Il2CppCodeGenWriteBarrier((&___setter_60), value);
- }
- inline static int32_t get_offset_of_tweenPlugin_61() { return static_cast<int32_t>(offsetof(TweenerCore_3_t1299559007, ___tweenPlugin_61)); }
- inline ABSTweenPlugin_3_t835568657 * get_tweenPlugin_61() const { return ___tweenPlugin_61; }
- inline ABSTweenPlugin_3_t835568657 ** get_address_of_tweenPlugin_61() { return &___tweenPlugin_61; }
- inline void set_tweenPlugin_61(ABSTweenPlugin_3_t835568657 * value)
- {
- ___tweenPlugin_61 = value;
- Il2CppCodeGenWriteBarrier((&___tweenPlugin_61), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEENERCORE_3_T1299559007_H
- #ifndef TWEENERCORE_3_T3040139253_H
- #define TWEENERCORE_3_T3040139253_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions>
- struct TweenerCore_3_t3040139253 : public Tweener_t436044680
- {
- public:
- // T2 DG.Tweening.Core.TweenerCore`3::startValue
- Path_t3614338981 * ___startValue_55;
- // T2 DG.Tweening.Core.TweenerCore`3::endValue
- Path_t3614338981 * ___endValue_56;
- // T2 DG.Tweening.Core.TweenerCore`3::changeValue
- Path_t3614338981 * ___changeValue_57;
- // TPlugOptions DG.Tweening.Core.TweenerCore`3::plugOptions
- PathOptions_t2074623791 ___plugOptions_58;
- // DG.Tweening.Core.DOGetter`1<T1> DG.Tweening.Core.TweenerCore`3::getter
- DOGetter_1_t3465109668 * ___getter_59;
- // DG.Tweening.Core.DOSetter`1<T1> DG.Tweening.Core.TweenerCore`3::setter
- DOSetter_1_t477454500 * ___setter_60;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<T1,T2,TPlugOptions> DG.Tweening.Core.TweenerCore`3::tweenPlugin
- ABSTweenPlugin_3_t2576148903 * ___tweenPlugin_61;
- public:
- inline static int32_t get_offset_of_startValue_55() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___startValue_55)); }
- inline Path_t3614338981 * get_startValue_55() const { return ___startValue_55; }
- inline Path_t3614338981 ** get_address_of_startValue_55() { return &___startValue_55; }
- inline void set_startValue_55(Path_t3614338981 * value)
- {
- ___startValue_55 = value;
- Il2CppCodeGenWriteBarrier((&___startValue_55), value);
- }
- inline static int32_t get_offset_of_endValue_56() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___endValue_56)); }
- inline Path_t3614338981 * get_endValue_56() const { return ___endValue_56; }
- inline Path_t3614338981 ** get_address_of_endValue_56() { return &___endValue_56; }
- inline void set_endValue_56(Path_t3614338981 * value)
- {
- ___endValue_56 = value;
- Il2CppCodeGenWriteBarrier((&___endValue_56), value);
- }
- inline static int32_t get_offset_of_changeValue_57() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___changeValue_57)); }
- inline Path_t3614338981 * get_changeValue_57() const { return ___changeValue_57; }
- inline Path_t3614338981 ** get_address_of_changeValue_57() { return &___changeValue_57; }
- inline void set_changeValue_57(Path_t3614338981 * value)
- {
- ___changeValue_57 = value;
- Il2CppCodeGenWriteBarrier((&___changeValue_57), value);
- }
- inline static int32_t get_offset_of_plugOptions_58() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___plugOptions_58)); }
- inline PathOptions_t2074623791 get_plugOptions_58() const { return ___plugOptions_58; }
- inline PathOptions_t2074623791 * get_address_of_plugOptions_58() { return &___plugOptions_58; }
- inline void set_plugOptions_58(PathOptions_t2074623791 value)
- {
- ___plugOptions_58 = value;
- }
- inline static int32_t get_offset_of_getter_59() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___getter_59)); }
- inline DOGetter_1_t3465109668 * get_getter_59() const { return ___getter_59; }
- inline DOGetter_1_t3465109668 ** get_address_of_getter_59() { return &___getter_59; }
- inline void set_getter_59(DOGetter_1_t3465109668 * value)
- {
- ___getter_59 = value;
- Il2CppCodeGenWriteBarrier((&___getter_59), value);
- }
- inline static int32_t get_offset_of_setter_60() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___setter_60)); }
- inline DOSetter_1_t477454500 * get_setter_60() const { return ___setter_60; }
- inline DOSetter_1_t477454500 ** get_address_of_setter_60() { return &___setter_60; }
- inline void set_setter_60(DOSetter_1_t477454500 * value)
- {
- ___setter_60 = value;
- Il2CppCodeGenWriteBarrier((&___setter_60), value);
- }
- inline static int32_t get_offset_of_tweenPlugin_61() { return static_cast<int32_t>(offsetof(TweenerCore_3_t3040139253, ___tweenPlugin_61)); }
- inline ABSTweenPlugin_3_t2576148903 * get_tweenPlugin_61() const { return ___tweenPlugin_61; }
- inline ABSTweenPlugin_3_t2576148903 ** get_address_of_tweenPlugin_61() { return &___tweenPlugin_61; }
- inline void set_tweenPlugin_61(ABSTweenPlugin_3_t2576148903 * value)
- {
- ___tweenPlugin_61 = value;
- Il2CppCodeGenWriteBarrier((&___tweenPlugin_61), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEENERCORE_3_T3040139253_H
- #ifndef TWEENERCORE_3_T2944330537_H
- #define TWEENERCORE_3_T2944330537_H
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions>
- struct TweenerCore_3_t2944330537 : public Tweener_t436044680
- {
- public:
- // T2 DG.Tweening.Core.TweenerCore`3::startValue
- Vector3_t3722313464 ___startValue_55;
- // T2 DG.Tweening.Core.TweenerCore`3::endValue
- Vector3_t3722313464 ___endValue_56;
- // T2 DG.Tweening.Core.TweenerCore`3::changeValue
- Vector3_t3722313464 ___changeValue_57;
- // TPlugOptions DG.Tweening.Core.TweenerCore`3::plugOptions
- VectorOptions_t1354903650 ___plugOptions_58;
- // DG.Tweening.Core.DOGetter`1<T1> DG.Tweening.Core.TweenerCore`3::getter
- DOGetter_1_t3465109668 * ___getter_59;
- // DG.Tweening.Core.DOSetter`1<T1> DG.Tweening.Core.TweenerCore`3::setter
- DOSetter_1_t477454500 * ___setter_60;
- // DG.Tweening.Plugins.Core.ABSTweenPlugin`3<T1,T2,TPlugOptions> DG.Tweening.Core.TweenerCore`3::tweenPlugin
- ABSTweenPlugin_3_t2480340187 * ___tweenPlugin_61;
- public:
- inline static int32_t get_offset_of_startValue_55() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___startValue_55)); }
- inline Vector3_t3722313464 get_startValue_55() const { return ___startValue_55; }
- inline Vector3_t3722313464 * get_address_of_startValue_55() { return &___startValue_55; }
- inline void set_startValue_55(Vector3_t3722313464 value)
- {
- ___startValue_55 = value;
- }
- inline static int32_t get_offset_of_endValue_56() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___endValue_56)); }
- inline Vector3_t3722313464 get_endValue_56() const { return ___endValue_56; }
- inline Vector3_t3722313464 * get_address_of_endValue_56() { return &___endValue_56; }
- inline void set_endValue_56(Vector3_t3722313464 value)
- {
- ___endValue_56 = value;
- }
- inline static int32_t get_offset_of_changeValue_57() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___changeValue_57)); }
- inline Vector3_t3722313464 get_changeValue_57() const { return ___changeValue_57; }
- inline Vector3_t3722313464 * get_address_of_changeValue_57() { return &___changeValue_57; }
- inline void set_changeValue_57(Vector3_t3722313464 value)
- {
- ___changeValue_57 = value;
- }
- inline static int32_t get_offset_of_plugOptions_58() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___plugOptions_58)); }
- inline VectorOptions_t1354903650 get_plugOptions_58() const { return ___plugOptions_58; }
- inline VectorOptions_t1354903650 * get_address_of_plugOptions_58() { return &___plugOptions_58; }
- inline void set_plugOptions_58(VectorOptions_t1354903650 value)
- {
- ___plugOptions_58 = value;
- }
- inline static int32_t get_offset_of_getter_59() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___getter_59)); }
- inline DOGetter_1_t3465109668 * get_getter_59() const { return ___getter_59; }
- inline DOGetter_1_t3465109668 ** get_address_of_getter_59() { return &___getter_59; }
- inline void set_getter_59(DOGetter_1_t3465109668 * value)
- {
- ___getter_59 = value;
- Il2CppCodeGenWriteBarrier((&___getter_59), value);
- }
- inline static int32_t get_offset_of_setter_60() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___setter_60)); }
- inline DOSetter_1_t477454500 * get_setter_60() const { return ___setter_60; }
- inline DOSetter_1_t477454500 ** get_address_of_setter_60() { return &___setter_60; }
- inline void set_setter_60(DOSetter_1_t477454500 * value)
- {
- ___setter_60 = value;
- Il2CppCodeGenWriteBarrier((&___setter_60), value);
- }
- inline static int32_t get_offset_of_tweenPlugin_61() { return static_cast<int32_t>(offsetof(TweenerCore_3_t2944330537, ___tweenPlugin_61)); }
- inline ABSTweenPlugin_3_t2480340187 * get_tweenPlugin_61() const { return ___tweenPlugin_61; }
- inline ABSTweenPlugin_3_t2480340187 ** get_address_of_tweenPlugin_61() { return &___tweenPlugin_61; }
- inline void set_tweenPlugin_61(ABSTweenPlugin_3_t2480340187 * value)
- {
- ___tweenPlugin_61 = value;
- Il2CppCodeGenWriteBarrier((&___tweenPlugin_61), value);
- }
- };
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #endif // TWEENERCORE_3_T2944330537_H
- // UnityEngine.Object[]
- struct ObjectU5BU5D_t1417781964 : public RuntimeArray
- {
- public:
- ALIGN_FIELD (8) Object_t631007953 * m_Items[1];
- public:
- inline Object_t631007953 * GetAt(il2cpp_array_size_t index) const
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items[index];
- }
- inline Object_t631007953 ** GetAddressAt(il2cpp_array_size_t index)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items + index;
- }
- inline void SetAt(il2cpp_array_size_t index, Object_t631007953 * value)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- m_Items[index] = value;
- Il2CppCodeGenWriteBarrier(m_Items + index, value);
- }
- inline Object_t631007953 * GetAtUnchecked(il2cpp_array_size_t index) const
- {
- return m_Items[index];
- }
- inline Object_t631007953 ** GetAddressAtUnchecked(il2cpp_array_size_t index)
- {
- return m_Items + index;
- }
- inline void SetAtUnchecked(il2cpp_array_size_t index, Object_t631007953 * value)
- {
- m_Items[index] = value;
- Il2CppCodeGenWriteBarrier(m_Items + index, value);
- }
- };
- // UnityEngine.Transform[]
- struct TransformU5BU5D_t807237628 : public RuntimeArray
- {
- public:
- ALIGN_FIELD (8) Transform_t3600365921 * m_Items[1];
- public:
- inline Transform_t3600365921 * GetAt(il2cpp_array_size_t index) const
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items[index];
- }
- inline Transform_t3600365921 ** GetAddressAt(il2cpp_array_size_t index)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items + index;
- }
- inline void SetAt(il2cpp_array_size_t index, Transform_t3600365921 * value)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- m_Items[index] = value;
- Il2CppCodeGenWriteBarrier(m_Items + index, value);
- }
- inline Transform_t3600365921 * GetAtUnchecked(il2cpp_array_size_t index) const
- {
- return m_Items[index];
- }
- inline Transform_t3600365921 ** GetAddressAtUnchecked(il2cpp_array_size_t index)
- {
- return m_Items + index;
- }
- inline void SetAtUnchecked(il2cpp_array_size_t index, Transform_t3600365921 * value)
- {
- m_Items[index] = value;
- Il2CppCodeGenWriteBarrier(m_Items + index, value);
- }
- };
- // System.Byte[]
- struct ByteU5BU5D_t4116647657 : public RuntimeArray
- {
- public:
- ALIGN_FIELD (8) uint8_t m_Items[1];
- public:
- inline uint8_t GetAt(il2cpp_array_size_t index) const
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items[index];
- }
- inline uint8_t* GetAddressAt(il2cpp_array_size_t index)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items + index;
- }
- inline void SetAt(il2cpp_array_size_t index, uint8_t value)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- m_Items[index] = value;
- }
- inline uint8_t GetAtUnchecked(il2cpp_array_size_t index) const
- {
- return m_Items[index];
- }
- inline uint8_t* GetAddressAtUnchecked(il2cpp_array_size_t index)
- {
- return m_Items + index;
- }
- inline void SetAtUnchecked(il2cpp_array_size_t index, uint8_t value)
- {
- m_Items[index] = value;
- }
- };
- // UnityEngine.Vector3[]
- struct Vector3U5BU5D_t1718750761 : public RuntimeArray
- {
- public:
- ALIGN_FIELD (8) Vector3_t3722313464 m_Items[1];
- public:
- inline Vector3_t3722313464 GetAt(il2cpp_array_size_t index) const
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items[index];
- }
- inline Vector3_t3722313464 * GetAddressAt(il2cpp_array_size_t index)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- return m_Items + index;
- }
- inline void SetAt(il2cpp_array_size_t index, Vector3_t3722313464 value)
- {
- IL2CPP_ARRAY_BOUNDS_CHECK(index, (uint32_t)(this)->max_length);
- m_Items[index] = value;
- }
- inline Vector3_t3722313464 GetAtUnchecked(il2cpp_array_size_t index) const
- {
- return m_Items[index];
- }
- inline Vector3_t3722313464 * GetAddressAtUnchecked(il2cpp_array_size_t index)
- {
- return m_Items + index;
- }
- inline void SetAtUnchecked(il2cpp_array_size_t index, Vector3_t3722313464 value)
- {
- m_Items[index] = value;
- }
- };
- // System.Boolean XLua.ObjectTranslator::Assignable<System.Object>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisRuntimeObject_m1919961448_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<UnityEngine.SkinQuality>(System.IntPtr,System.Int32,T&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_TisSkinQuality_t4231844520_m2385978519_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, int32_t* ___v2, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Vector3>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Space>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<UnityEngine.Space>(System.IntPtr,System.Int32,T&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_TisSpace_t654135784_m3053450216_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, int32_t* ___v2, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.RotateMode>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.AxisConstraint>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<System.Nullable`1<UnityEngine.Vector3>>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisNullable_1_t1149908250_m1171964725_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<System.Nullable`1<UnityEngine.Vector3>>(System.IntPtr,System.Int32,T&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_TisNullable_1_t1149908250_m3400041693_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Nullable_1_t1149908250 * ___v2, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.PathMode>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.PathType>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<System.Nullable`1<UnityEngine.Color>>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<System.Nullable`1<UnityEngine.Color>>(System.IntPtr,System.Int32,T&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Nullable_1_t4278248406 * ___v2, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Vector2>(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_gshared (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap___CreateInstance_m2101056957 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_FindObjectsOfTypeAll_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_Load_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_Load_xlua_st__m291082337 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_LoadAsync_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_LoadAll_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_GetBuiltinResource_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_UnloadAsset_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_UnloadUnusedAssets_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Void System.Object::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void Object__ctor_m297566312 (RuntimeObject * __this, const RuntimeMethod* method);
- // XLua.ObjectTranslatorPool XLua.ObjectTranslatorPool::get_Instance()
- extern "C" IL2CPP_METHOD_ATTR ObjectTranslatorPool_t158158286 * ObjectTranslatorPool_get_Instance_m842665354 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // XLua.ObjectTranslator XLua.ObjectTranslatorPool::Find(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR ObjectTranslator_t2020767555 * ObjectTranslatorPool_Find_m2808149378 (ObjectTranslatorPool_t158158286 * __this, intptr_t ___L0, const RuntimeMethod* method);
- // System.Type System.Type::GetTypeFromHandle(System.RuntimeTypeHandle)
- extern "C" IL2CPP_METHOD_ATTR Type_t * Type_GetTypeFromHandle_m1620074514 (RuntimeObject * __this /* static, unused */, RuntimeTypeHandle_t3027515415 p0, const RuntimeMethod* method);
- // System.Void XLua.Utils::BeginObjectRegister(System.Type,System.IntPtr,XLua.ObjectTranslator,System.Int32,System.Int32,System.Int32,System.Int32,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR void Utils_BeginObjectRegister_m972381667 (RuntimeObject * __this /* static, unused */, Type_t * ___type0, intptr_t ___L1, ObjectTranslator_t2020767555 * ___translator2, int32_t ___meta_count3, int32_t ___method_count4, int32_t ___getter_count5, int32_t ___setter_count6, int32_t ___type_id7, const RuntimeMethod* method);
- // System.Void XLua.Utils::EndObjectRegister(System.Type,System.IntPtr,XLua.ObjectTranslator,XLua.LuaDLL.lua_CSFunction,XLua.LuaDLL.lua_CSFunction,System.Type,XLua.LuaDLL.lua_CSFunction,XLua.LuaDLL.lua_CSFunction)
- extern "C" IL2CPP_METHOD_ATTR void Utils_EndObjectRegister_m3642684994 (RuntimeObject * __this /* static, unused */, Type_t * ___type0, intptr_t ___L1, ObjectTranslator_t2020767555 * ___translator2, lua_CSFunction_t883524059 * ___csIndexer3, lua_CSFunction_t883524059 * ___csNewIndexer4, Type_t * ___base_type5, lua_CSFunction_t883524059 * ___arrayIndexer6, lua_CSFunction_t883524059 * ___arrayNewIndexer7, const RuntimeMethod* method);
- // System.Void XLua.LuaDLL.lua_CSFunction::.ctor(System.Object,System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void lua_CSFunction__ctor_m2895663127 (lua_CSFunction_t883524059 * __this, RuntimeObject * ___object0, intptr_t ___method1, const RuntimeMethod* method);
- // System.Void XLua.Utils::BeginClassRegister(System.Type,System.IntPtr,XLua.LuaDLL.lua_CSFunction,System.Int32,System.Int32,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR void Utils_BeginClassRegister_m3630094254 (RuntimeObject * __this /* static, unused */, Type_t * ___type0, intptr_t ___L1, lua_CSFunction_t883524059 * ___creator2, int32_t ___class_field_count3, int32_t ___static_getter_count4, int32_t ___static_setter_count5, const RuntimeMethod* method);
- // System.Void XLua.Utils::RegisterFunc(System.IntPtr,System.Int32,System.String,XLua.LuaDLL.lua_CSFunction)
- extern "C" IL2CPP_METHOD_ATTR void Utils_RegisterFunc_m1228226546 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___idx1, String_t* ___name2, lua_CSFunction_t883524059 * ___func3, const RuntimeMethod* method);
- // System.Void XLua.Utils::EndClassRegister(System.Type,System.IntPtr,XLua.ObjectTranslator)
- extern "C" IL2CPP_METHOD_ATTR void Utils_EndClassRegister_m1460189367 (RuntimeObject * __this /* static, unused */, Type_t * ___type0, intptr_t ___L1, ObjectTranslator_t2020767555 * ___translator2, const RuntimeMethod* method);
- // System.Int32 XLua.LuaDLL.Lua::lua_gettop(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t Lua_lua_gettop_m2394536141 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Void UnityEngine.Resources::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void Resources__ctor_m2750237692 (Resources_t2942265397 * __this, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Push(System.IntPtr,System.Object)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Push_m105918116 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, RuntimeObject * ___o1, const RuntimeMethod* method);
- // System.String System.String::Concat(System.Object,System.Object)
- extern "C" IL2CPP_METHOD_ATTR String_t* String_Concat_m904156431 (RuntimeObject * __this /* static, unused */, RuntimeObject * p0, RuntimeObject * p1, const RuntimeMethod* method);
- // System.Int32 XLua.LuaDLL.Lua::luaL_error(System.IntPtr,System.String)
- extern "C" IL2CPP_METHOD_ATTR int32_t Lua_luaL_error_m1118924357 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, String_t* ___message1, const RuntimeMethod* method);
- // System.Object XLua.ObjectTranslator::GetObject(System.IntPtr,System.Int32,System.Type)
- extern "C" IL2CPP_METHOD_ATTR RuntimeObject * ObjectTranslator_GetObject_m805173647 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Type_t * ___type2, const RuntimeMethod* method);
- // UnityEngine.Object[] UnityEngine.Resources::FindObjectsOfTypeAll(System.Type)
- extern "C" IL2CPP_METHOD_ATTR ObjectU5BU5D_t1417781964* Resources_FindObjectsOfTypeAll_m3764733868 (RuntimeObject * __this /* static, unused */, Type_t * p0, const RuntimeMethod* method);
- // System.Boolean XLua.LuaDLL.Lua::lua_isnil(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool Lua_lua_isnil_m3293895152 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // XLua.LuaTypes XLua.LuaDLL.Lua::lua_type(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR int32_t Lua_lua_type_m1302598900 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.String XLua.LuaDLL.Lua::lua_tostring(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR String_t* Lua_lua_tostring_m2201066917 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // UnityEngine.Object UnityEngine.Resources::Load(System.String)
- extern "C" IL2CPP_METHOD_ATTR Object_t631007953 * Resources_Load_m3880010804 (RuntimeObject * __this /* static, unused */, String_t* p0, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<System.Type>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisType_t_m2942600910(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisRuntimeObject_m1919961448_gshared)(__this, ___L0, ___index1, method)
- // UnityEngine.Object UnityEngine.Resources::Load(System.String,System.Type)
- extern "C" IL2CPP_METHOD_ATTR Object_t631007953 * Resources_Load_m3480190876 (RuntimeObject * __this /* static, unused */, String_t* p0, Type_t * p1, const RuntimeMethod* method);
- // UnityEngine.ResourceRequest UnityEngine.Resources::LoadAsync(System.String)
- extern "C" IL2CPP_METHOD_ATTR ResourceRequest_t3109103591 * Resources_LoadAsync_m1433713934 (RuntimeObject * __this /* static, unused */, String_t* p0, const RuntimeMethod* method);
- // UnityEngine.ResourceRequest UnityEngine.Resources::LoadAsync(System.String,System.Type)
- extern "C" IL2CPP_METHOD_ATTR ResourceRequest_t3109103591 * Resources_LoadAsync_m1988772635 (RuntimeObject * __this /* static, unused */, String_t* p0, Type_t * p1, const RuntimeMethod* method);
- // UnityEngine.Object[] UnityEngine.Resources::LoadAll(System.String)
- extern "C" IL2CPP_METHOD_ATTR ObjectU5BU5D_t1417781964* Resources_LoadAll_m2792647427 (RuntimeObject * __this /* static, unused */, String_t* p0, const RuntimeMethod* method);
- // UnityEngine.Object[] UnityEngine.Resources::LoadAll(System.String,System.Type)
- extern "C" IL2CPP_METHOD_ATTR ObjectU5BU5D_t1417781964* Resources_LoadAll_m1574480108 (RuntimeObject * __this /* static, unused */, String_t* p0, Type_t * p1, const RuntimeMethod* method);
- // UnityEngine.Object UnityEngine.Resources::GetBuiltinResource(System.Type,System.String)
- extern "C" IL2CPP_METHOD_ATTR Object_t631007953 * Resources_GetBuiltinResource_m3641967638 (RuntimeObject * __this /* static, unused */, Type_t * p0, String_t* p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Resources::UnloadAsset(UnityEngine.Object)
- extern "C" IL2CPP_METHOD_ATTR void Resources_UnloadAsset_m4120664229 (RuntimeObject * __this /* static, unused */, Object_t631007953 * p0, const RuntimeMethod* method);
- // UnityEngine.AsyncOperation UnityEngine.Resources::UnloadUnusedAssets()
- extern "C" IL2CPP_METHOD_ATTR AsyncOperation_t1445031843 * Resources_UnloadUnusedAssets_m2836736321 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_m_GetBlendShapeWeight(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_m_SetBlendShapeWeight(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_m_BakeMesh(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_bones(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_quality(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_updateWhenOffscreen(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_rootBone(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_sharedMesh(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_skinnedMotionVectors(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_localBounds(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_bones(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_quality(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_updateWhenOffscreen(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_rootBone(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_sharedMesh(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_skinnedMotionVectors(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_localBounds(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer__ctor_m3041302873 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // System.Object XLua.ObjectTranslator::FastGetCSObj(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR RuntimeObject * ObjectTranslator_FastGetCSObj_m66620763 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Int32 XLua.LuaDLL.Lua::xlua_tointeger(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR int32_t Lua_xlua_tointeger_m2263761157 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Single UnityEngine.SkinnedMeshRenderer::GetBlendShapeWeight(System.Int32)
- extern "C" IL2CPP_METHOD_ATTR float SkinnedMeshRenderer_GetBlendShapeWeight_m2096074612 (SkinnedMeshRenderer_t245602842 * __this, int32_t p0, const RuntimeMethod* method);
- // System.Void XLua.LuaDLL.Lua::lua_pushnumber(System.IntPtr,System.Double)
- extern "C" IL2CPP_METHOD_ATTR void Lua_lua_pushnumber_m3190857213 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, double ___number1, const RuntimeMethod* method);
- // System.Double XLua.LuaDLL.Lua::lua_tonumber(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR double Lua_lua_tonumber_m3087017991 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::SetBlendShapeWeight(System.Int32,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_SetBlendShapeWeight_m3755486032 (SkinnedMeshRenderer_t245602842 * __this, int32_t p0, float p1, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::BakeMesh(UnityEngine.Mesh)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_BakeMesh_m2270373039 (SkinnedMeshRenderer_t245602842 * __this, Mesh_t3648964284 * p0, const RuntimeMethod* method);
- // UnityEngine.Transform[] UnityEngine.SkinnedMeshRenderer::get_bones()
- extern "C" IL2CPP_METHOD_ATTR TransformU5BU5D_t807237628* SkinnedMeshRenderer_get_bones_m333719399 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // UnityEngine.SkinQuality UnityEngine.SkinnedMeshRenderer::get_quality()
- extern "C" IL2CPP_METHOD_ATTR int32_t SkinnedMeshRenderer_get_quality_m2793860528 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // System.Boolean UnityEngine.SkinnedMeshRenderer::get_updateWhenOffscreen()
- extern "C" IL2CPP_METHOD_ATTR bool SkinnedMeshRenderer_get_updateWhenOffscreen_m322274263 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // System.Void XLua.LuaDLL.Lua::lua_pushboolean(System.IntPtr,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR void Lua_lua_pushboolean_m2404392622 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, bool ___value1, const RuntimeMethod* method);
- // UnityEngine.Transform UnityEngine.SkinnedMeshRenderer::get_rootBone()
- extern "C" IL2CPP_METHOD_ATTR Transform_t3600365921 * SkinnedMeshRenderer_get_rootBone_m1530334984 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // UnityEngine.Mesh UnityEngine.SkinnedMeshRenderer::get_sharedMesh()
- extern "C" IL2CPP_METHOD_ATTR Mesh_t3648964284 * SkinnedMeshRenderer_get_sharedMesh_m1611698282 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // System.Boolean UnityEngine.SkinnedMeshRenderer::get_skinnedMotionVectors()
- extern "C" IL2CPP_METHOD_ATTR bool SkinnedMeshRenderer_get_skinnedMotionVectors_m1202820987 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // UnityEngine.Bounds UnityEngine.SkinnedMeshRenderer::get_localBounds()
- extern "C" IL2CPP_METHOD_ATTR Bounds_t2266837910 SkinnedMeshRenderer_get_localBounds_m2798545833 (SkinnedMeshRenderer_t245602842 * __this, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::PushUnityEngineBounds(System.IntPtr,UnityEngine.Bounds)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_PushUnityEngineBounds_m1034727825 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, Bounds_t2266837910 ___val1, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::set_bones(UnityEngine.Transform[])
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_bones_m4136734710 (SkinnedMeshRenderer_t245602842 * __this, TransformU5BU5D_t807237628* p0, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<UnityEngine.SkinQuality>(System.IntPtr,System.Int32,T&)
- #define ObjectTranslator_Get_TisSkinQuality_t4231844520_m2385978519(__this, ___L0, ___index1, ___v2, method) (( void (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, int32_t*, const RuntimeMethod*))ObjectTranslator_Get_TisSkinQuality_t4231844520_m2385978519_gshared)(__this, ___L0, ___index1, ___v2, method)
- // System.Void UnityEngine.SkinnedMeshRenderer::set_quality(UnityEngine.SkinQuality)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_quality_m699927355 (SkinnedMeshRenderer_t245602842 * __this, int32_t p0, const RuntimeMethod* method);
- // System.Boolean XLua.LuaDLL.Lua::lua_toboolean(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR bool Lua_lua_toboolean_m3020476153 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___index1, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::set_updateWhenOffscreen(System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_updateWhenOffscreen_m3087825351 (SkinnedMeshRenderer_t245602842 * __this, bool p0, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::set_rootBone(UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_rootBone_m4271355631 (SkinnedMeshRenderer_t245602842 * __this, Transform_t3600365921 * p0, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::set_sharedMesh(UnityEngine.Mesh)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_sharedMesh_m2397334786 (SkinnedMeshRenderer_t245602842 * __this, Mesh_t3648964284 * p0, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::set_skinnedMotionVectors(System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_skinnedMotionVectors_m3578095715 (SkinnedMeshRenderer_t245602842 * __this, bool p0, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,UnityEngine.Bounds&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m4012846247 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Bounds_t2266837910 * ___val2, const RuntimeMethod* method);
- // System.Void UnityEngine.SkinnedMeshRenderer::set_localBounds(UnityEngine.Bounds)
- extern "C" IL2CPP_METHOD_ATTR void SkinnedMeshRenderer_set_localBounds_m2847626607 (SkinnedMeshRenderer_t245602842 * __this, Bounds_t2266837910 p0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap___CreateInstance_m788894500 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::_m_ToString(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap__m_ToString_m2000840227 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::_g_get_text(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap__g_get_text_m2083243538 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::_g_get_bytes(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap__g_get_bytes_m819075780 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Void UnityEngine.TextAsset::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void TextAsset__ctor_m2405005845 (TextAsset_t3022178571 * __this, const RuntimeMethod* method);
- // System.Void XLua.LuaDLL.Lua::lua_pushstring(System.IntPtr,System.String)
- extern "C" IL2CPP_METHOD_ATTR void Lua_lua_pushstring_m4067524778 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, String_t* ___str1, const RuntimeMethod* method);
- // System.String UnityEngine.TextAsset::get_text()
- extern "C" IL2CPP_METHOD_ATTR String_t* TextAsset_get_text_m2027878391 (TextAsset_t3022178571 * __this, const RuntimeMethod* method);
- // System.Byte[] UnityEngine.TextAsset::get_bytes()
- extern "C" IL2CPP_METHOD_ATTR ByteU5BU5D_t4116647657* TextAsset_get_bytes_m1826471440 (TextAsset_t3022178571 * __this, const RuntimeMethod* method);
- // System.Void XLua.LuaDLL.Lua::lua_pushstring(System.IntPtr,System.Byte[])
- extern "C" IL2CPP_METHOD_ATTR void Lua_lua_pushstring_m3272202343 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, ByteU5BU5D_t4116647657* ___str1, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap___CreateInstance_m626113703 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_time(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_time_m1863490483 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_timeSinceLevelLoad(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_deltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_deltaTime_m201033604 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedTime_m1141309118 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_unscaledTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_unscaledTime_m1722259242 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedUnscaledTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_unscaledDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedUnscaledDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_maximumDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_smoothDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_maximumParticleDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_timeScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_timeScale_m3205244298 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_frameCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_frameCount_m2155433661 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_renderedFrameCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_realtimeSinceStartup(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_captureFramerate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_captureFramerate_m587593122 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_inFixedTimeStep(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_fixedDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_maximumDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_maximumParticleDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_timeScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_timeScale_m2124012409 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_captureFramerate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_captureFramerate_m3614803111 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Void UnityEngine.Time::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void Time__ctor_m872844386 (Time_t2420636075 * __this, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_time()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_time_m2907476221 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_timeSinceLevelLoad()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_timeSinceLevelLoad_m2224611026 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_deltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_deltaTime_m372706562 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_fixedTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_fixedTime_m908791845 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_unscaledTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_unscaledTime_m3457564332 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_fixedUnscaledTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_fixedUnscaledTime_m2438369752 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_unscaledDeltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_unscaledDeltaTime_m4270080131 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_fixedUnscaledDeltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_fixedUnscaledDeltaTime_m3271579190 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_fixedDeltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_fixedDeltaTime_m3595802076 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_maximumDeltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_maximumDeltaTime_m557735545 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_smoothDeltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_smoothDeltaTime_m2285259559 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_maximumParticleDeltaTime()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_maximumParticleDeltaTime_m3370030886 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_timeScale()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_timeScale_m701790074 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Time::get_frameCount()
- extern "C" IL2CPP_METHOD_ATTR int32_t Time_get_frameCount_m1220035214 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Void XLua.LuaDLL.Lua::xlua_pushinteger(System.IntPtr,System.Int32)
- extern "C" IL2CPP_METHOD_ATTR void Lua_xlua_pushinteger_m3473749366 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, int32_t ___value1, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Time::get_renderedFrameCount()
- extern "C" IL2CPP_METHOD_ATTR int32_t Time_get_renderedFrameCount_m3445787045 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Single UnityEngine.Time::get_realtimeSinceStartup()
- extern "C" IL2CPP_METHOD_ATTR float Time_get_realtimeSinceStartup_m3141794964 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Time::get_captureFramerate()
- extern "C" IL2CPP_METHOD_ATTR int32_t Time_get_captureFramerate_m4129865328 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Boolean UnityEngine.Time::get_inFixedTimeStep()
- extern "C" IL2CPP_METHOD_ATTR bool Time_get_inFixedTimeStep_m4031040766 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // System.Void UnityEngine.Time::set_fixedDeltaTime(System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Time_set_fixedDeltaTime_m2452744972 (RuntimeObject * __this /* static, unused */, float p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Time::set_maximumDeltaTime(System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Time_set_maximumDeltaTime_m2052127828 (RuntimeObject * __this /* static, unused */, float p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Time::set_maximumParticleDeltaTime(System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Time_set_maximumParticleDeltaTime_m2614608890 (RuntimeObject * __this /* static, unused */, float p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Time::set_timeScale(System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Time_set_timeScale_m1127545364 (RuntimeObject * __this /* static, unused */, float p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Time::set_captureFramerate(System.Int32)
- extern "C" IL2CPP_METHOD_ATTR void Time_set_captureFramerate_m161064716 (RuntimeObject * __this /* static, unused */, int32_t p0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap___CreateInstance_m1894308163 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetParent(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetParent_m804936730 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetPositionAndRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_Translate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_Translate_m975680681 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_Rotate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_Rotate_m1066480346 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_RotateAround(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_RotateAround_m3000108533 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_LookAt(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_LookAt_m1878060840 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_TransformDirection(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_TransformDirection_m4138306096 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_InverseTransformDirection(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_TransformVector(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_TransformVector_m1514244944 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_InverseTransformVector(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_InverseTransformVector_m1349495655 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_TransformPoint(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_TransformPoint_m1078881144 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_InverseTransformPoint(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_InverseTransformPoint_m957968118 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DetachChildren(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DetachChildren_m520041245 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetAsFirstSibling(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetAsLastSibling(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetSiblingIndex(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_GetSiblingIndex(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_Find(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_Find_m1578719640 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_IsChildOf(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_IsChildOf_m764668816 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_GetEnumerator(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_GetEnumerator_m2850786488 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_GetChild(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_GetChild_m1976232125 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMove(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMove_m2510464153 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMoveX(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMoveX_m427706497 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMoveY(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMoveY_m3829814726 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMoveZ(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMoveZ_m3431864067 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMove(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMove_m602687662 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMoveX(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMoveY(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMoveZ(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DORotate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DORotate_m825617719 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DORotateQuaternion(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalRotate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalRotate_m4095437176 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalRotateQuaternion(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScale_m1896281278 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScaleX(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScaleX_m2063790813 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScaleY(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScaleY_m3874994172 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScaleZ(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScaleZ_m976566461 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLookAt(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLookAt_m89020156 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPunchPosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPunchPosition_m1266900073 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPunchScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPunchScale_m2535020043 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPunchRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPunchRotation_m3158922004 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOShakePosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOShakePosition_m3720856662 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOShakeRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOShakeRotation_m241003690 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOShakeScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOShakeScale_m2406116869 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOJump(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOJump_m4133327798 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalJump(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalJump_m296616187 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPath(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPath_m2509685622 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalPath(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalPath_m442715724 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableMoveBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableLocalMoveBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableRotateBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableLocalRotateBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendablePunchRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableScaleBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_position(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_position_m2180048924 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localPosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localPosition_m3878105019 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_eulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_eulerAngles_m3922999519 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localEulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_right(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_right_m469775628 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_up(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_up_m3208095539 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_forward(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_forward_m2765842083 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_rotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_rotation_m1745653753 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localRotation_m637984894 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localScale_m3915212871 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_parent(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_parent_m3003513812 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_worldToLocalMatrix(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localToWorldMatrix(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_root(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_root_m58896500 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_childCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_childCount_m222537369 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_lossyScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_lossyScale_m3129807950 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_hasChanged(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_hasChanged_m2133940418 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_hierarchyCapacity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_hierarchyCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_position(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_position_m2248180735 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localPosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localPosition_m572438127 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_eulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_eulerAngles_m2405101980 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localEulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_right(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_right_m1502050898 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_up(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_up_m1616193993 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_forward(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_forward_m1425629139 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_rotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_rotation_m2344385924 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localRotation_m3029152408 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localScale_m1212933853 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_parent(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_parent_m3451686420 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_hasChanged(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_hasChanged_m195551608 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_hierarchyCapacity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Transform>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisRuntimeObject_m1919961448_gshared)(__this, ___L0, ___index1, method)
- // System.Void UnityEngine.Transform::SetParent(UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR void Transform_SetParent_m381167889 (Transform_t3600365921 * __this, Transform_t3600365921 * p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::SetParent(UnityEngine.Transform,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR void Transform_SetParent_m273471670 (Transform_t3600365921 * __this, Transform_t3600365921 * p0, bool p1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,UnityEngine.Vector3&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m1627229423 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Vector3_t3722313464 * ___val2, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,UnityEngine.Quaternion&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m3946340519 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Quaternion_t2301928331 * ___val2, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::SetPositionAndRotation(UnityEngine.Vector3,UnityEngine.Quaternion)
- extern "C" IL2CPP_METHOD_ATTR void Transform_SetPositionAndRotation_m2620258152 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, Quaternion_t2301928331 p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Translate(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Translate_m3762500149 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Vector3>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_gshared)(__this, ___L0, ___index1, method)
- // System.Void UnityEngine.Transform::Translate(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Translate_m1810197270 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Space>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_gshared)(__this, ___L0, ___index1, method)
- // System.Void XLua.ObjectTranslator::Get<UnityEngine.Space>(System.IntPtr,System.Int32,T&)
- #define ObjectTranslator_Get_TisSpace_t654135784_m3053450216(__this, ___L0, ___index1, ___v2, method) (( void (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, int32_t*, const RuntimeMethod*))ObjectTranslator_Get_TisSpace_t654135784_m3053450216_gshared)(__this, ___L0, ___index1, ___v2, method)
- // System.Void UnityEngine.Transform::Translate(System.Single,System.Single,System.Single,UnityEngine.Space)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Translate_m2198936091 (Transform_t3600365921 * __this, float p0, float p1, float p2, int32_t p3, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Translate(System.Single,System.Single,System.Single,UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Translate_m182585230 (Transform_t3600365921 * __this, float p0, float p1, float p2, Transform_t3600365921 * p3, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Translate(UnityEngine.Vector3,UnityEngine.Space)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Translate_m1990195114 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, int32_t p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Translate(UnityEngine.Vector3,UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Translate_m1458128769 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, Transform_t3600365921 * p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Rotate(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Rotate_m3172098886 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Rotate(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Rotate_m720511863 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Rotate(UnityEngine.Vector3,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Rotate_m1749346957 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, float p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Rotate(System.Single,System.Single,System.Single,UnityEngine.Space)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Rotate_m1660364534 (Transform_t3600365921 * __this, float p0, float p1, float p2, int32_t p3, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Rotate(UnityEngine.Vector3,UnityEngine.Space)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Rotate_m1886816857 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, int32_t p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::Rotate(UnityEngine.Vector3,System.Single,UnityEngine.Space)
- extern "C" IL2CPP_METHOD_ATTR void Transform_Rotate_m1538690078 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, float p1, int32_t p2, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::RotateAround(UnityEngine.Vector3,UnityEngine.Vector3,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Transform_RotateAround_m2651195670 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, Vector3_t3722313464 p1, float p2, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::LookAt(UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR void Transform_LookAt_m3968184312 (Transform_t3600365921 * __this, Transform_t3600365921 * p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::LookAt(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_LookAt_m3649447396 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::LookAt(UnityEngine.Transform,UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_LookAt_m2637417695 (Transform_t3600365921 * __this, Transform_t3600365921 * p0, Vector3_t3722313464 p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::LookAt(UnityEngine.Vector3,UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_LookAt_m3639503211 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, Vector3_t3722313464 p1, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::TransformDirection(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_TransformDirection_m3193513622 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::PushUnityEngineVector3(System.IntPtr,UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_PushUnityEngineVector3_m82247743 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, Vector3_t3722313464 ___val1, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::TransformDirection(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_TransformDirection_m3784028109 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::InverseTransformDirection(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_InverseTransformDirection_m351876368 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::InverseTransformDirection(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_InverseTransformDirection_m3843238577 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::TransformVector(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_TransformVector_m1386854030 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::TransformVector(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_TransformVector_m1951285617 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::InverseTransformVector(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_InverseTransformVector_m1918399765 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::InverseTransformVector(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_InverseTransformVector_m3855973661 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::TransformPoint(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_TransformPoint_m4024714202 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::TransformPoint(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_TransformPoint_m226827784 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::InverseTransformPoint(System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_InverseTransformPoint_m1060740552 (Transform_t3600365921 * __this, float p0, float p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::InverseTransformPoint(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_InverseTransformPoint_m1343916000 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::DetachChildren()
- extern "C" IL2CPP_METHOD_ATTR void Transform_DetachChildren_m3266231651 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::SetAsFirstSibling()
- extern "C" IL2CPP_METHOD_ATTR void Transform_SetAsFirstSibling_m253439912 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::SetAsLastSibling()
- extern "C" IL2CPP_METHOD_ATTR void Transform_SetAsLastSibling_m3949169710 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::SetSiblingIndex(System.Int32)
- extern "C" IL2CPP_METHOD_ATTR void Transform_SetSiblingIndex_m1077399982 (Transform_t3600365921 * __this, int32_t p0, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Transform::GetSiblingIndex()
- extern "C" IL2CPP_METHOD_ATTR int32_t Transform_GetSiblingIndex_m798637244 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Transform UnityEngine.Transform::Find(System.String)
- extern "C" IL2CPP_METHOD_ATTR Transform_t3600365921 * Transform_Find_m1729760951 (Transform_t3600365921 * __this, String_t* p0, const RuntimeMethod* method);
- // System.Boolean UnityEngine.Transform::IsChildOf(UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR bool Transform_IsChildOf_m224006092 (Transform_t3600365921 * __this, Transform_t3600365921 * p0, const RuntimeMethod* method);
- // System.Collections.IEnumerator UnityEngine.Transform::GetEnumerator()
- extern "C" IL2CPP_METHOD_ATTR RuntimeObject* Transform_GetEnumerator_m2717073726 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::PushAny(System.IntPtr,System.Object)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_PushAny_m2595410231 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, RuntimeObject * ___o1, const RuntimeMethod* method);
- // UnityEngine.Transform UnityEngine.Transform::GetChild(System.Int32)
- extern "C" IL2CPP_METHOD_ATTR Transform_t3600365921 * Transform_GetChild_m1092972975 (Transform_t3600365921 * __this, int32_t p0, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOMove(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOMove_m2811406016 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOMoveX(UnityEngine.Transform,System.Single,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOMoveX_m2454328326 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOMoveY(UnityEngine.Transform,System.Single,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOMoveY_m3448206952 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOMoveZ(UnityEngine.Transform,System.Single,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOMoveZ_m96258396 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOLocalMove(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOLocalMove_m1613685430 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOLocalMoveX(UnityEngine.Transform,System.Single,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOLocalMoveX_m2461473870 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOLocalMoveY(UnityEngine.Transform,System.Single,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOLocalMoveY_m2924342502 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOLocalMoveZ(UnityEngine.Transform,System.Single,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOLocalMoveZ_m1503641773 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, bool p3, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.RotateMode>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_gshared)(__this, ___L0, ___index1, method)
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,DG.Tweening.RotateMode&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m1355366945 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, int32_t* ___val2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Vector3,DG.Tweening.Plugins.Options.QuaternionOptions> DG.Tweening.ShortcutExtensions::DORotate(UnityEngine.Transform,UnityEngine.Vector3,System.Single,DG.Tweening.RotateMode)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t1299559007 * ShortcutExtensions_DORotate_m1865406243 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Quaternion,DG.Tweening.Plugins.Options.NoOptions> DG.Tweening.ShortcutExtensions::DORotateQuaternion(UnityEngine.Transform,UnityEngine.Quaternion,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t3785815898 * ShortcutExtensions_DORotateQuaternion_m3329673556 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Quaternion_t2301928331 p1, float p2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Vector3,DG.Tweening.Plugins.Options.QuaternionOptions> DG.Tweening.ShortcutExtensions::DOLocalRotate(UnityEngine.Transform,UnityEngine.Vector3,System.Single,DG.Tweening.RotateMode)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t1299559007 * ShortcutExtensions_DOLocalRotate_m2010640997 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Quaternion,UnityEngine.Quaternion,DG.Tweening.Plugins.Options.NoOptions> DG.Tweening.ShortcutExtensions::DOLocalRotateQuaternion(UnityEngine.Transform,UnityEngine.Quaternion,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t3785815898 * ShortcutExtensions_DOLocalRotateQuaternion_m3341936535 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Quaternion_t2301928331 p1, float p2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOScale(UnityEngine.Transform,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOScale_m3402774733 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOScale(UnityEngine.Transform,UnityEngine.Vector3,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOScale_m495885115 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOScaleX(UnityEngine.Transform,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOScaleX_m44278897 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOScaleY(UnityEngine.Transform,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOScaleY_m3341920956 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,UnityEngine.Vector3,DG.Tweening.Plugins.Options.VectorOptions> DG.Tweening.ShortcutExtensions::DOScaleZ(UnityEngine.Transform,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t2944330537 * ShortcutExtensions_DOScaleZ_m3535152065 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.AxisConstraint>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570_gshared)(__this, ___L0, ___index1, method)
- // System.Boolean XLua.ObjectTranslator::Assignable<System.Nullable`1<UnityEngine.Vector3>>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisNullable_1_t1149908250_m1171964725(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisNullable_1_t1149908250_m1171964725_gshared)(__this, ___L0, ___index1, method)
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,DG.Tweening.AxisConstraint&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m3189878663 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, int32_t* ___val2, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<System.Nullable`1<UnityEngine.Vector3>>(System.IntPtr,System.Int32,T&)
- #define ObjectTranslator_Get_TisNullable_1_t1149908250_m3400041693(__this, ___L0, ___index1, ___v2, method) (( void (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, Nullable_1_t1149908250 *, const RuntimeMethod*))ObjectTranslator_Get_TisNullable_1_t1149908250_m3400041693_gshared)(__this, ___L0, ___index1, ___v2, method)
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOLookAt(UnityEngine.Transform,UnityEngine.Vector3,System.Single,DG.Tweening.AxisConstraint,System.Nullable`1<UnityEngine.Vector3>)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOLookAt_m735541971 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, Nullable_1_t1149908250 p4, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOPunchPosition(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOPunchPosition_m2646086740 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOPunchScale(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Int32,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOPunchScale_m4912217 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, float p4, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOPunchRotation(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Int32,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOPunchRotation_m3077511679 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, float p4, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOShakePosition(UnityEngine.Transform,System.Single,System.Single,System.Int32,System.Single,System.Boolean,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOShakePosition_m1859704350 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, int32_t p3, float p4, bool p5, bool p6, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOShakePosition(UnityEngine.Transform,System.Single,UnityEngine.Vector3,System.Int32,System.Single,System.Boolean,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOShakePosition_m3797325453 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, Vector3_t3722313464 p2, int32_t p3, float p4, bool p5, bool p6, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOShakeRotation(UnityEngine.Transform,System.Single,System.Single,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOShakeRotation_m4209883749 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOShakeRotation(UnityEngine.Transform,System.Single,UnityEngine.Vector3,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOShakeRotation_m2216829550 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, Vector3_t3722313464 p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOShakeScale(UnityEngine.Transform,System.Single,System.Single,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOShakeScale_m1145516565 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, float p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOShakeScale(UnityEngine.Transform,System.Single,UnityEngine.Vector3,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOShakeScale_m2697446006 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, float p1, Vector3_t3722313464 p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // DG.Tweening.Sequence DG.Tweening.ShortcutExtensions::DOJump(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Sequence_t2050373119 * ShortcutExtensions_DOJump_m2824502518 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // DG.Tweening.Sequence DG.Tweening.ShortcutExtensions::DOLocalJump(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Int32,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Sequence_t2050373119 * ShortcutExtensions_DOLocalJump_m2308167039 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, float p4, bool p5, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.Plugins.Core.PathCore.Path>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisRuntimeObject_m1919961448_gshared)(__this, ___L0, ___index1, method)
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.PathMode>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_gshared)(__this, ___L0, ___index1, method)
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,DG.Tweening.PathMode&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m2906801996 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, int32_t* ___val2, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions> DG.Tweening.ShortcutExtensions::DOPath(UnityEngine.Transform,DG.Tweening.Plugins.Core.PathCore.Path,System.Single,DG.Tweening.PathMode)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t3040139253 * ShortcutExtensions_DOPath_m1737185059 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Path_t3614338981 * p1, float p2, int32_t p3, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Vector3[]>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisRuntimeObject_m1919961448_gshared)(__this, ___L0, ___index1, method)
- // System.Boolean XLua.ObjectTranslator::Assignable<DG.Tweening.PathType>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_gshared)(__this, ___L0, ___index1, method)
- // System.Boolean XLua.ObjectTranslator::Assignable<System.Nullable`1<UnityEngine.Color>>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576_gshared)(__this, ___L0, ___index1, method)
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,DG.Tweening.PathType&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m3757128783 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, int32_t* ___val2, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::Get<System.Nullable`1<UnityEngine.Color>>(System.IntPtr,System.Int32,T&)
- #define ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195(__this, ___L0, ___index1, ___v2, method) (( void (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, Nullable_1_t4278248406 *, const RuntimeMethod*))ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195_gshared)(__this, ___L0, ___index1, ___v2, method)
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions> DG.Tweening.ShortcutExtensions::DOPath(UnityEngine.Transform,UnityEngine.Vector3[],System.Single,DG.Tweening.PathType,DG.Tweening.PathMode,System.Int32,System.Nullable`1<UnityEngine.Color>)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t3040139253 * ShortcutExtensions_DOPath_m1170749557 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3U5BU5D_t1718750761* p1, float p2, int32_t p3, int32_t p4, int32_t p5, Nullable_1_t4278248406 p6, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions> DG.Tweening.ShortcutExtensions::DOLocalPath(UnityEngine.Transform,DG.Tweening.Plugins.Core.PathCore.Path,System.Single,DG.Tweening.PathMode)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t3040139253 * ShortcutExtensions_DOLocalPath_m3367906890 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Path_t3614338981 * p1, float p2, int32_t p3, const RuntimeMethod* method);
- // DG.Tweening.Core.TweenerCore`3<UnityEngine.Vector3,DG.Tweening.Plugins.Core.PathCore.Path,DG.Tweening.Plugins.Options.PathOptions> DG.Tweening.ShortcutExtensions::DOLocalPath(UnityEngine.Transform,UnityEngine.Vector3[],System.Single,DG.Tweening.PathType,DG.Tweening.PathMode,System.Int32,System.Nullable`1<UnityEngine.Color>)
- extern "C" IL2CPP_METHOD_ATTR TweenerCore_3_t3040139253 * ShortcutExtensions_DOLocalPath_m3183460192 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3U5BU5D_t1718750761* p1, float p2, int32_t p3, int32_t p4, int32_t p5, Nullable_1_t4278248406 p6, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOBlendableMoveBy(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOBlendableMoveBy_m533616323 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOBlendableLocalMoveBy(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOBlendableLocalMoveBy_m150910410 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, bool p3, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOBlendableRotateBy(UnityEngine.Transform,UnityEngine.Vector3,System.Single,DG.Tweening.RotateMode)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOBlendableRotateBy_m899197017 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOBlendableLocalRotateBy(UnityEngine.Transform,UnityEngine.Vector3,System.Single,DG.Tweening.RotateMode)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOBlendableLocalRotateBy_m1249688942 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOBlendablePunchRotation(UnityEngine.Transform,UnityEngine.Vector3,System.Single,System.Int32,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOBlendablePunchRotation_m2677664895 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, int32_t p3, float p4, const RuntimeMethod* method);
- // DG.Tweening.Tweener DG.Tweening.ShortcutExtensions::DOBlendableScaleBy(UnityEngine.Transform,UnityEngine.Vector3,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Tweener_t436044680 * ShortcutExtensions_DOBlendableScaleBy_m209393549 (RuntimeObject * __this /* static, unused */, Transform_t3600365921 * p0, Vector3_t3722313464 p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_position()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_position_m36019626 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_localPosition()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_localPosition_m4234289348 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_eulerAngles()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_eulerAngles_m2743581774 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_localEulerAngles()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_localEulerAngles_m2136926248 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_right()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_right_m2535262102 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_up()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_up_m3972993886 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_forward()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_forward_m747522392 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Quaternion UnityEngine.Transform::get_rotation()
- extern "C" IL2CPP_METHOD_ATTR Quaternion_t2301928331 Transform_get_rotation_m3502953881 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::PushUnityEngineQuaternion(System.IntPtr,UnityEngine.Quaternion)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_PushUnityEngineQuaternion_m1385659755 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, Quaternion_t2301928331 ___val1, const RuntimeMethod* method);
- // UnityEngine.Quaternion UnityEngine.Transform::get_localRotation()
- extern "C" IL2CPP_METHOD_ATTR Quaternion_t2301928331 Transform_get_localRotation_m3487911431 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_localScale()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_localScale_m129152068 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Transform UnityEngine.Transform::get_parent()
- extern "C" IL2CPP_METHOD_ATTR Transform_t3600365921 * Transform_get_parent_m835071599 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Matrix4x4 UnityEngine.Transform::get_worldToLocalMatrix()
- extern "C" IL2CPP_METHOD_ATTR Matrix4x4_t1817901843 Transform_get_worldToLocalMatrix_m399704877 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Matrix4x4 UnityEngine.Transform::get_localToWorldMatrix()
- extern "C" IL2CPP_METHOD_ATTR Matrix4x4_t1817901843 Transform_get_localToWorldMatrix_m4155710351 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Transform UnityEngine.Transform::get_root()
- extern "C" IL2CPP_METHOD_ATTR Transform_t3600365921 * Transform_get_root_m2450402596 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Transform::get_childCount()
- extern "C" IL2CPP_METHOD_ATTR int32_t Transform_get_childCount_m3145433196 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector3 UnityEngine.Transform::get_lossyScale()
- extern "C" IL2CPP_METHOD_ATTR Vector3_t3722313464 Transform_get_lossyScale_m465496651 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Boolean UnityEngine.Transform::get_hasChanged()
- extern "C" IL2CPP_METHOD_ATTR bool Transform_get_hasChanged_m186929804 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Transform::get_hierarchyCapacity()
- extern "C" IL2CPP_METHOD_ATTR int32_t Transform_get_hierarchyCapacity_m724776931 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Transform::get_hierarchyCount()
- extern "C" IL2CPP_METHOD_ATTR int32_t Transform_get_hierarchyCount_m1774644847 (Transform_t3600365921 * __this, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_position(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_position_m3387557959 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_localPosition(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_localPosition_m4128471975 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_eulerAngles(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_eulerAngles_m135219616 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_localEulerAngles(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_localEulerAngles_m4202601546 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_right(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_right_m1787339266 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_up(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_up_m3321958190 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_forward(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_forward_m1840797198 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_rotation(UnityEngine.Quaternion)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_rotation_m3524318132 (Transform_t3600365921 * __this, Quaternion_t2301928331 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_localRotation(UnityEngine.Quaternion)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_localRotation_m19445462 (Transform_t3600365921 * __this, Quaternion_t2301928331 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_localScale(UnityEngine.Vector3)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_localScale_m3053443106 (Transform_t3600365921 * __this, Vector3_t3722313464 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_parent(UnityEngine.Transform)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_parent_m786917804 (Transform_t3600365921 * __this, Transform_t3600365921 * p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_hasChanged(System.Boolean)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_hasChanged_m4213723989 (Transform_t3600365921 * __this, bool p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Transform::set_hierarchyCapacity(System.Int32)
- extern "C" IL2CPP_METHOD_ATTR void Transform_set_hierarchyCapacity_m813979291 (Transform_t3600365921 * __this, int32_t p0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___CreateInstance_m3609981491 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__CSIndexer(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___CSIndexer_m1160094481 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__NewIndexer(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___NewIndexer_m2412137810 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__AddMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___AddMeta_m377273840 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__SubMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___SubMeta_m2441875035 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__UnmMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___UnmMeta_m4167622536 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__MulMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___MulMeta_m3110680190 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__DivMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___DivMeta_m697562865 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__EqMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___EqMeta_m3842372935 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Set(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Set_m4206157458 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Lerp_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_LerpUnclamped_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_MoveTowards_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Scale_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Scale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Scale_m3402797960 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Normalize(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Normalize_m2064805032 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_ToString(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_ToString_m3633924156 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_GetHashCode(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_GetHashCode_m3805233334 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Equals(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Equals_m4260714512 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Reflect_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Dot_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Angle_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SignedAngle_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Distance_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_ClampMagnitude_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SqrMagnitude_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SqrMagnitude(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Min_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Max_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SmoothDamp_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_normalized(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_normalized_m1526536551 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_magnitude(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_magnitude_m1920742942 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_sqrMagnitude(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_zero(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_zero_m4234870038 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_one(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_one_m1876688525 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_up(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_up_m2923378165 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_down(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_down_m2946352740 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_left(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_left_m158211399 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_right(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_right_m77832184 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_positiveInfinity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_negativeInfinity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_x(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_x_m4147433016 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_y(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_y_m2714693255 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_s_set_x(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__s_set_x_m2341483890 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_s_set_y(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__s_set_y_m3798992961 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method);
- // System.Void XLua.Utils::RegisterObject(System.IntPtr,XLua.ObjectTranslator,System.Int32,System.String,System.Object)
- extern "C" IL2CPP_METHOD_ATTR void Utils_RegisterObject_m691522261 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, ObjectTranslator_t2020767555 * ___translator1, int32_t ___idx2, String_t* ___name3, RuntimeObject * ___obj4, const RuntimeMethod* method);
- // System.Void UnityEngine.Vector2::.ctor(System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Vector2__ctor_m3970636864 (Vector2_t2156229523 * __this, float p0, float p1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::PushUnityEngineVector2(System.IntPtr,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_PushUnityEngineVector2_m3232111227 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, Vector2_t2156229523 ___val1, const RuntimeMethod* method);
- // System.Boolean XLua.ObjectTranslator::Assignable<UnityEngine.Vector2>(System.IntPtr,System.Int32)
- #define ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(__this, ___L0, ___index1, method) (( bool (*) (ObjectTranslator_t2020767555 *, intptr_t, int32_t, const RuntimeMethod*))ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_gshared)(__this, ___L0, ___index1, method)
- // System.Void XLua.ObjectTranslator::Get(System.IntPtr,System.Int32,UnityEngine.Vector2&)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_Get_m1627229422 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Vector2_t2156229523 * ___val2, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::get_Item(System.Int32)
- extern "C" IL2CPP_METHOD_ATTR float Vector2_get_Item_m3559215723 (Vector2_t2156229523 * __this, int32_t p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Vector2::set_Item(System.Int32,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Vector2_set_Item_m3557490725 (Vector2_t2156229523 * __this, int32_t p0, float p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::op_Addition(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_op_Addition_m800700293 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::op_Subtraction(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_op_Subtraction_m73004381 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::op_UnaryNegation(UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_op_UnaryNegation_m2172448356 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::op_Multiply(UnityEngine.Vector2,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_op_Multiply_m2347887432 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, float p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::op_Multiply(System.Single,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_op_Multiply_m3294489634 (RuntimeObject * __this /* static, unused */, float p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::op_Division(UnityEngine.Vector2,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_op_Division_m132623573 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, float p1, const RuntimeMethod* method);
- // System.Boolean UnityEngine.Vector2::op_Equality(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR bool Vector2_op_Equality_m2303255133 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Vector2::Set(System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR void Vector2_Set_m3780194483 (Vector2_t2156229523 * __this, float p0, float p1, const RuntimeMethod* method);
- // System.Void XLua.ObjectTranslator::UpdateUnityEngineVector2(System.IntPtr,System.Int32,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR void ObjectTranslator_UpdateUnityEngineVector2_m2314138213 (ObjectTranslator_t2020767555 * __this, intptr_t ___L0, int32_t ___index1, Vector2_t2156229523 ___val2, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::Lerp(UnityEngine.Vector2,UnityEngine.Vector2,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_Lerp_m854472224 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::LerpUnclamped(UnityEngine.Vector2,UnityEngine.Vector2,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_LerpUnclamped_m1574157890 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::MoveTowards(UnityEngine.Vector2,UnityEngine.Vector2,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_MoveTowards_m456668783 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, float p2, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::Scale(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_Scale_m165605769 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // System.Void UnityEngine.Vector2::Scale(UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR void Vector2_Scale_m4286416168 (Vector2_t2156229523 * __this, Vector2_t2156229523 p0, const RuntimeMethod* method);
- // System.Void UnityEngine.Vector2::Normalize()
- extern "C" IL2CPP_METHOD_ATTR void Vector2_Normalize_m1906922873 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // System.String UnityEngine.Vector2::ToString()
- extern "C" IL2CPP_METHOD_ATTR String_t* Vector2_ToString_m1205609053 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // System.String UnityEngine.Vector2::ToString(System.String)
- extern "C" IL2CPP_METHOD_ATTR String_t* Vector2_ToString_m2296514517 (Vector2_t2156229523 * __this, String_t* p0, const RuntimeMethod* method);
- // System.Int32 UnityEngine.Vector2::GetHashCode()
- extern "C" IL2CPP_METHOD_ATTR int32_t Vector2_GetHashCode_m3916089713 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // System.Boolean UnityEngine.Vector2::Equals(System.Object)
- extern "C" IL2CPP_METHOD_ATTR bool Vector2_Equals_m832062989 (Vector2_t2156229523 * __this, RuntimeObject * ___other0, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::Reflect(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_Reflect_m4187417778 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::Dot(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR float Vector2_Dot_m1554553447 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::Angle(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR float Vector2_Angle_m4105581454 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::SignedAngle(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR float Vector2_SignedAngle_m1664554214 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::Distance(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR float Vector2_Distance_m3048868881 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::ClampMagnitude(UnityEngine.Vector2,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_ClampMagnitude_m1438220061 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, float p1, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::SqrMagnitude(UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR float Vector2_SqrMagnitude_m2414967581 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::SqrMagnitude()
- extern "C" IL2CPP_METHOD_ATTR float Vector2_SqrMagnitude_m2507415696 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::Min(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_Min_m1808913837 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::Max(UnityEngine.Vector2,UnityEngine.Vector2)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_Max_m2539715210 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::SmoothDamp(UnityEngine.Vector2,UnityEngine.Vector2,UnityEngine.Vector2&,System.Single,System.Single,System.Single)
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_SmoothDamp_m1183918543 (RuntimeObject * __this /* static, unused */, Vector2_t2156229523 p0, Vector2_t2156229523 p1, Vector2_t2156229523 * p2, float p3, float p4, float p5, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_normalized()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_normalized_m2683665860 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::get_magnitude()
- extern "C" IL2CPP_METHOD_ATTR float Vector2_get_magnitude_m2752892833 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // System.Single UnityEngine.Vector2::get_sqrMagnitude()
- extern "C" IL2CPP_METHOD_ATTR float Vector2_get_sqrMagnitude_m837837635 (Vector2_t2156229523 * __this, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_zero()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_zero_m540426400 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_one()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_one_m738793577 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_up()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_up_m2647420593 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_down()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_down_m2886001705 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_left()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_left_m1559018038 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_right()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_right_m1027081661 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_positiveInfinity()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_positiveInfinity_m1229371315 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- // UnityEngine.Vector2 UnityEngine.Vector2::get_negativeInfinity()
- extern "C" IL2CPP_METHOD_ATTR Vector2_t2156229523 Vector2_get_negativeInfinity_m1601170781 (RuntimeObject * __this /* static, unused */, const RuntimeMethod* method);
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap___CreateInstance_m2101056957(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap___CreateInstance_m2101056957(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_Load_xlua_st__m291082337(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_Load_xlua_st__m291082337(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821(NULL, ___L0, NULL);
- return returnValue;
- }
- // System.Void XLua.CSObjectWrap.UnityEngineResourcesWrap::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineResourcesWrap__ctor_m690684970 (UnityEngineResourcesWrap_t3776895103 * __this, const RuntimeMethod* method)
- {
- {
- Object__ctor_m297566312(__this, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Void XLua.CSObjectWrap.UnityEngineResourcesWrap::__Register(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineResourcesWrap___Register_m3828081545 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap___Register_m3828081545_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- intptr_t G_B2_0;
- memset(&G_B2_0, 0, sizeof(G_B2_0));
- Type_t * G_B2_1 = NULL;
- intptr_t G_B1_0;
- memset(&G_B1_0, 0, sizeof(G_B1_0));
- Type_t * G_B1_1 = NULL;
- String_t* G_B4_0 = NULL;
- int32_t G_B4_1 = 0;
- intptr_t G_B4_2;
- memset(&G_B4_2, 0, sizeof(G_B4_2));
- String_t* G_B3_0 = NULL;
- int32_t G_B3_1 = 0;
- intptr_t G_B3_2;
- memset(&G_B3_2, 0, sizeof(G_B3_2));
- String_t* G_B6_0 = NULL;
- int32_t G_B6_1 = 0;
- intptr_t G_B6_2;
- memset(&G_B6_2, 0, sizeof(G_B6_2));
- String_t* G_B5_0 = NULL;
- int32_t G_B5_1 = 0;
- intptr_t G_B5_2;
- memset(&G_B5_2, 0, sizeof(G_B5_2));
- String_t* G_B8_0 = NULL;
- int32_t G_B8_1 = 0;
- intptr_t G_B8_2;
- memset(&G_B8_2, 0, sizeof(G_B8_2));
- String_t* G_B7_0 = NULL;
- int32_t G_B7_1 = 0;
- intptr_t G_B7_2;
- memset(&G_B7_2, 0, sizeof(G_B7_2));
- String_t* G_B10_0 = NULL;
- int32_t G_B10_1 = 0;
- intptr_t G_B10_2;
- memset(&G_B10_2, 0, sizeof(G_B10_2));
- String_t* G_B9_0 = NULL;
- int32_t G_B9_1 = 0;
- intptr_t G_B9_2;
- memset(&G_B9_2, 0, sizeof(G_B9_2));
- String_t* G_B12_0 = NULL;
- int32_t G_B12_1 = 0;
- intptr_t G_B12_2;
- memset(&G_B12_2, 0, sizeof(G_B12_2));
- String_t* G_B11_0 = NULL;
- int32_t G_B11_1 = 0;
- intptr_t G_B11_2;
- memset(&G_B11_2, 0, sizeof(G_B11_2));
- String_t* G_B14_0 = NULL;
- int32_t G_B14_1 = 0;
- intptr_t G_B14_2;
- memset(&G_B14_2, 0, sizeof(G_B14_2));
- String_t* G_B13_0 = NULL;
- int32_t G_B13_1 = 0;
- intptr_t G_B13_2;
- memset(&G_B13_2, 0, sizeof(G_B13_2));
- String_t* G_B16_0 = NULL;
- int32_t G_B16_1 = 0;
- intptr_t G_B16_2;
- memset(&G_B16_2, 0, sizeof(G_B16_2));
- String_t* G_B15_0 = NULL;
- int32_t G_B15_1 = 0;
- intptr_t G_B15_2;
- memset(&G_B15_2, 0, sizeof(G_B15_2));
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- RuntimeTypeHandle_t3027515415 L_3 = { reinterpret_cast<intptr_t> (Resources_t2942265397_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_4 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- Type_t * L_5 = V_1;
- intptr_t L_6 = ___L0;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- Utils_BeginObjectRegister_m972381667(NULL /*static, unused*/, L_5, L_6, L_7, 0, 0, 0, 0, (-1), /*hidden argument*/NULL);
- Type_t * L_8 = V_1;
- intptr_t L_9 = ___L0;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- Utils_EndObjectRegister_m3642684994(NULL /*static, unused*/, L_8, L_9, L_10, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, (Type_t *)NULL, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, /*hidden argument*/NULL);
- Type_t * L_11 = V_1;
- intptr_t L_12 = ___L0;
- lua_CSFunction_t883524059 * L_13 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- G_B1_0 = L_12;
- G_B1_1 = L_11;
- if (L_13)
- {
- G_B2_0 = L_12;
- G_B2_1 = L_11;
- goto IL_004b;
- }
- }
- {
- intptr_t L_14 = (intptr_t)UnityEngineResourcesWrap___CreateInstance_m2101056957_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_15 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_15, NULL, L_14, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache0_0(L_15);
- G_B2_0 = G_B1_0;
- G_B2_1 = G_B1_1;
- }
- IL_004b:
- {
- lua_CSFunction_t883524059 * L_16 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- Utils_BeginClassRegister_m3630094254(NULL /*static, unused*/, G_B2_1, G_B2_0, L_16, 8, 0, 0, /*hidden argument*/NULL);
- intptr_t L_17 = ___L0;
- lua_CSFunction_t883524059 * L_18 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- G_B3_0 = _stringLiteral875055564;
- G_B3_1 = ((int32_t)-4);
- G_B3_2 = L_17;
- if (L_18)
- {
- G_B4_0 = _stringLiteral875055564;
- G_B4_1 = ((int32_t)-4);
- G_B4_2 = L_17;
- goto IL_0078;
- }
- }
- {
- intptr_t L_19 = (intptr_t)UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_20 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_20, NULL, L_19, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1_1(L_20);
- G_B4_0 = G_B3_0;
- G_B4_1 = G_B3_1;
- G_B4_2 = G_B3_2;
- }
- IL_0078:
- {
- lua_CSFunction_t883524059 * L_21 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B4_2, G_B4_1, G_B4_0, L_21, /*hidden argument*/NULL);
- intptr_t L_22 = ___L0;
- lua_CSFunction_t883524059 * L_23 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- G_B5_0 = _stringLiteral432140041;
- G_B5_1 = ((int32_t)-4);
- G_B5_2 = L_22;
- if (L_23)
- {
- G_B6_0 = _stringLiteral432140041;
- G_B6_1 = ((int32_t)-4);
- G_B6_2 = L_22;
- goto IL_00a2;
- }
- }
- {
- intptr_t L_24 = (intptr_t)UnityEngineResourcesWrap__m_Load_xlua_st__m291082337_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_25 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_25, NULL, L_24, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2_2(L_25);
- G_B6_0 = G_B5_0;
- G_B6_1 = G_B5_1;
- G_B6_2 = G_B5_2;
- }
- IL_00a2:
- {
- lua_CSFunction_t883524059 * L_26 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B6_2, G_B6_1, G_B6_0, L_26, /*hidden argument*/NULL);
- intptr_t L_27 = ___L0;
- lua_CSFunction_t883524059 * L_28 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- G_B7_0 = _stringLiteral1174336103;
- G_B7_1 = ((int32_t)-4);
- G_B7_2 = L_27;
- if (L_28)
- {
- G_B8_0 = _stringLiteral1174336103;
- G_B8_1 = ((int32_t)-4);
- G_B8_2 = L_27;
- goto IL_00cc;
- }
- }
- {
- intptr_t L_29 = (intptr_t)UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_30 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_30, NULL, L_29, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3_3(L_30);
- G_B8_0 = G_B7_0;
- G_B8_1 = G_B7_1;
- G_B8_2 = G_B7_2;
- }
- IL_00cc:
- {
- lua_CSFunction_t883524059 * L_31 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B8_2, G_B8_1, G_B8_0, L_31, /*hidden argument*/NULL);
- intptr_t L_32 = ___L0;
- lua_CSFunction_t883524059 * L_33 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- G_B9_0 = _stringLiteral1258524496;
- G_B9_1 = ((int32_t)-4);
- G_B9_2 = L_32;
- if (L_33)
- {
- G_B10_0 = _stringLiteral1258524496;
- G_B10_1 = ((int32_t)-4);
- G_B10_2 = L_32;
- goto IL_00f6;
- }
- }
- {
- intptr_t L_34 = (intptr_t)UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_35 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_35, NULL, L_34, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4_4(L_35);
- G_B10_0 = G_B9_0;
- G_B10_1 = G_B9_1;
- G_B10_2 = G_B9_2;
- }
- IL_00f6:
- {
- lua_CSFunction_t883524059 * L_36 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B10_2, G_B10_1, G_B10_0, L_36, /*hidden argument*/NULL);
- intptr_t L_37 = ___L0;
- lua_CSFunction_t883524059 * L_38 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- G_B11_0 = _stringLiteral4110426868;
- G_B11_1 = ((int32_t)-4);
- G_B11_2 = L_37;
- if (L_38)
- {
- G_B12_0 = _stringLiteral4110426868;
- G_B12_1 = ((int32_t)-4);
- G_B12_2 = L_37;
- goto IL_0120;
- }
- }
- {
- intptr_t L_39 = (intptr_t)UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_40 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_40, NULL, L_39, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache5_5(L_40);
- G_B12_0 = G_B11_0;
- G_B12_1 = G_B11_1;
- G_B12_2 = G_B11_2;
- }
- IL_0120:
- {
- lua_CSFunction_t883524059 * L_41 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B12_2, G_B12_1, G_B12_0, L_41, /*hidden argument*/NULL);
- intptr_t L_42 = ___L0;
- lua_CSFunction_t883524059 * L_43 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- G_B13_0 = _stringLiteral1538031842;
- G_B13_1 = ((int32_t)-4);
- G_B13_2 = L_42;
- if (L_43)
- {
- G_B14_0 = _stringLiteral1538031842;
- G_B14_1 = ((int32_t)-4);
- G_B14_2 = L_42;
- goto IL_014a;
- }
- }
- {
- intptr_t L_44 = (intptr_t)UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_45 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_45, NULL, L_44, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache6_6(L_45);
- G_B14_0 = G_B13_0;
- G_B14_1 = G_B13_1;
- G_B14_2 = G_B13_2;
- }
- IL_014a:
- {
- lua_CSFunction_t883524059 * L_46 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B14_2, G_B14_1, G_B14_0, L_46, /*hidden argument*/NULL);
- intptr_t L_47 = ___L0;
- lua_CSFunction_t883524059 * L_48 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- G_B15_0 = _stringLiteral2136762679;
- G_B15_1 = ((int32_t)-4);
- G_B15_2 = L_47;
- if (L_48)
- {
- G_B16_0 = _stringLiteral2136762679;
- G_B16_1 = ((int32_t)-4);
- G_B16_2 = L_47;
- goto IL_0174;
- }
- }
- {
- intptr_t L_49 = (intptr_t)UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_50 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_50, NULL, L_49, /*hidden argument*/NULL);
- ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache7_7(L_50);
- G_B16_0 = G_B15_0;
- G_B16_1 = G_B15_1;
- G_B16_2 = G_B15_2;
- }
- IL_0174:
- {
- lua_CSFunction_t883524059 * L_51 = ((UnityEngineResourcesWrap_t3776895103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineResourcesWrap_t3776895103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B16_2, G_B16_1, G_B16_0, L_51, /*hidden argument*/NULL);
- Type_t * L_52 = V_1;
- intptr_t L_53 = ___L0;
- ObjectTranslator_t2020767555 * L_54 = V_0;
- Utils_EndClassRegister_m1460189367(NULL /*static, unused*/, L_52, L_53, L_54, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap___CreateInstance_m2101056957 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap___CreateInstance_m2101056957_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Resources_t2942265397 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_4) == ((uint32_t)1))))
- {
- goto IL_002d;
- }
- }
- IL_0018:
- {
- Resources_t2942265397 * L_5 = (Resources_t2942265397 *)il2cpp_codegen_object_new(Resources_t2942265397_il2cpp_TypeInfo_var);
- Resources__ctor_m2750237692(L_5, /*hidden argument*/NULL);
- V_1 = L_5;
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Resources_t2942265397 * L_8 = V_1;
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_8, /*hidden argument*/NULL);
- V_2 = 1;
- goto IL_0056;
- }
- IL_002d:
- {
- goto IL_004a;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0032;
- throw e;
- }
- CATCH_0032:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_2 = L_12;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_004a:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, _stringLiteral457645061, /*hidden argument*/NULL);
- return L_14;
- }
- IL_0056:
- {
- int32_t L_15 = V_2;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_FindObjectsOfTypeAll_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_FindObjectsOfTypeAll_xlua_st__m3630472427_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- ObjectU5BU5D_t1417781964* V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- RuntimeTypeHandle_t3027515415 L_5 = { reinterpret_cast<intptr_t> (Type_t_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_6 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_5, /*hidden argument*/NULL);
- NullCheck(L_3);
- RuntimeObject * L_7 = ObjectTranslator_GetObject_m805173647(L_3, L_4, 1, L_6, /*hidden argument*/NULL);
- V_1 = ((Type_t *)CastclassClass((RuntimeObject*)L_7, Type_t_il2cpp_TypeInfo_var));
- Type_t * L_8 = V_1;
- ObjectU5BU5D_t1417781964* L_9 = Resources_FindObjectsOfTypeAll_m3764733868(NULL /*static, unused*/, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- ObjectU5BU5D_t1417781964* L_12 = V_2;
- NullCheck(L_10);
- ObjectTranslator_Push_m105918116(L_10, L_11, (RuntimeObject *)(RuntimeObject *)L_12, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0054;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003a;
- throw e;
- }
- CATCH_003a:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_3 = L_16;
- goto IL_0054;
- } // end catch (depth: 1)
- IL_0054:
- {
- int32_t L_17 = V_3;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_Load_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_Load_xlua_st__m291082337 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_Load_xlua_st__m291082337_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- int32_t V_1 = 0;
- String_t* V_2 = NULL;
- Object_t631007953 * V_3 = NULL;
- int32_t V_4 = 0;
- String_t* V_5 = NULL;
- Type_t * V_6 = NULL;
- Object_t631007953 * V_7 = NULL;
- Exception_t * V_8 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- int32_t L_5 = V_1;
- if ((!(((uint32_t)L_5) == ((uint32_t)1))))
- {
- goto IL_0052;
- }
- }
- IL_001a:
- {
- intptr_t L_6 = ___L0;
- bool L_7 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_6, 1, /*hidden argument*/NULL);
- if (L_7)
- {
- goto IL_0033;
- }
- }
- IL_0026:
- {
- intptr_t L_8 = ___L0;
- int32_t L_9 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_8, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_9) == ((uint32_t)4))))
- {
- goto IL_0052;
- }
- }
- IL_0033:
- {
- intptr_t L_10 = ___L0;
- String_t* L_11 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_10, 1, /*hidden argument*/NULL);
- V_2 = L_11;
- String_t* L_12 = V_2;
- Object_t631007953 * L_13 = Resources_Load_m3880010804(NULL /*static, unused*/, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- Object_t631007953 * L_16 = V_3;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00e9;
- }
- IL_0052:
- {
- int32_t L_17 = V_1;
- if ((!(((uint32_t)L_17) == ((uint32_t)2))))
- {
- goto IL_00bd;
- }
- }
- IL_0059:
- {
- intptr_t L_18 = ___L0;
- bool L_19 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_18, 1, /*hidden argument*/NULL);
- if (L_19)
- {
- goto IL_0072;
- }
- }
- IL_0065:
- {
- intptr_t L_20 = ___L0;
- int32_t L_21 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_20, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_21) == ((uint32_t)4))))
- {
- goto IL_00bd;
- }
- }
- IL_0072:
- {
- ObjectTranslator_t2020767555 * L_22 = V_0;
- intptr_t L_23 = ___L0;
- NullCheck(L_22);
- bool L_24 = ObjectTranslator_Assignable_TisType_t_m2942600910(L_22, L_23, 2, /*hidden argument*/ObjectTranslator_Assignable_TisType_t_m2942600910_RuntimeMethod_var);
- if (!L_24)
- {
- goto IL_00bd;
- }
- }
- IL_007f:
- {
- intptr_t L_25 = ___L0;
- String_t* L_26 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_25, 1, /*hidden argument*/NULL);
- V_5 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- RuntimeTypeHandle_t3027515415 L_29 = { reinterpret_cast<intptr_t> (Type_t_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_30 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_29, /*hidden argument*/NULL);
- NullCheck(L_27);
- RuntimeObject * L_31 = ObjectTranslator_GetObject_m805173647(L_27, L_28, 2, L_30, /*hidden argument*/NULL);
- V_6 = ((Type_t *)CastclassClass((RuntimeObject*)L_31, Type_t_il2cpp_TypeInfo_var));
- String_t* L_32 = V_5;
- Type_t * L_33 = V_6;
- Object_t631007953 * L_34 = Resources_Load_m3480190876(NULL /*static, unused*/, L_32, L_33, /*hidden argument*/NULL);
- V_7 = L_34;
- ObjectTranslator_t2020767555 * L_35 = V_0;
- intptr_t L_36 = ___L0;
- Object_t631007953 * L_37 = V_7;
- NullCheck(L_35);
- ObjectTranslator_Push_m105918116(L_35, L_36, L_37, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00e9;
- }
- IL_00bd:
- {
- goto IL_00dd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c2;
- throw e;
- }
- CATCH_00c2:
- { // begin catch(System.Exception)
- V_8 = ((Exception_t *)__exception_local);
- intptr_t L_38 = ___L0;
- Exception_t * L_39 = V_8;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_40 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_39, /*hidden argument*/NULL);
- int32_t L_41 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_38, L_40, /*hidden argument*/NULL);
- V_4 = L_41;
- goto IL_00e9;
- } // end catch (depth: 1)
- IL_00dd:
- {
- intptr_t L_42 = ___L0;
- int32_t L_43 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_42, _stringLiteral91211816, /*hidden argument*/NULL);
- return L_43;
- }
- IL_00e9:
- {
- int32_t L_44 = V_4;
- return L_44;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_LoadAsync_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_LoadAsync_xlua_st__m3191344299_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- int32_t V_1 = 0;
- String_t* V_2 = NULL;
- ResourceRequest_t3109103591 * V_3 = NULL;
- int32_t V_4 = 0;
- String_t* V_5 = NULL;
- Type_t * V_6 = NULL;
- ResourceRequest_t3109103591 * V_7 = NULL;
- Exception_t * V_8 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- int32_t L_5 = V_1;
- if ((!(((uint32_t)L_5) == ((uint32_t)1))))
- {
- goto IL_0052;
- }
- }
- IL_001a:
- {
- intptr_t L_6 = ___L0;
- bool L_7 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_6, 1, /*hidden argument*/NULL);
- if (L_7)
- {
- goto IL_0033;
- }
- }
- IL_0026:
- {
- intptr_t L_8 = ___L0;
- int32_t L_9 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_8, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_9) == ((uint32_t)4))))
- {
- goto IL_0052;
- }
- }
- IL_0033:
- {
- intptr_t L_10 = ___L0;
- String_t* L_11 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_10, 1, /*hidden argument*/NULL);
- V_2 = L_11;
- String_t* L_12 = V_2;
- ResourceRequest_t3109103591 * L_13 = Resources_LoadAsync_m1433713934(NULL /*static, unused*/, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- ResourceRequest_t3109103591 * L_16 = V_3;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00e9;
- }
- IL_0052:
- {
- int32_t L_17 = V_1;
- if ((!(((uint32_t)L_17) == ((uint32_t)2))))
- {
- goto IL_00bd;
- }
- }
- IL_0059:
- {
- intptr_t L_18 = ___L0;
- bool L_19 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_18, 1, /*hidden argument*/NULL);
- if (L_19)
- {
- goto IL_0072;
- }
- }
- IL_0065:
- {
- intptr_t L_20 = ___L0;
- int32_t L_21 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_20, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_21) == ((uint32_t)4))))
- {
- goto IL_00bd;
- }
- }
- IL_0072:
- {
- ObjectTranslator_t2020767555 * L_22 = V_0;
- intptr_t L_23 = ___L0;
- NullCheck(L_22);
- bool L_24 = ObjectTranslator_Assignable_TisType_t_m2942600910(L_22, L_23, 2, /*hidden argument*/ObjectTranslator_Assignable_TisType_t_m2942600910_RuntimeMethod_var);
- if (!L_24)
- {
- goto IL_00bd;
- }
- }
- IL_007f:
- {
- intptr_t L_25 = ___L0;
- String_t* L_26 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_25, 1, /*hidden argument*/NULL);
- V_5 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- RuntimeTypeHandle_t3027515415 L_29 = { reinterpret_cast<intptr_t> (Type_t_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_30 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_29, /*hidden argument*/NULL);
- NullCheck(L_27);
- RuntimeObject * L_31 = ObjectTranslator_GetObject_m805173647(L_27, L_28, 2, L_30, /*hidden argument*/NULL);
- V_6 = ((Type_t *)CastclassClass((RuntimeObject*)L_31, Type_t_il2cpp_TypeInfo_var));
- String_t* L_32 = V_5;
- Type_t * L_33 = V_6;
- ResourceRequest_t3109103591 * L_34 = Resources_LoadAsync_m1988772635(NULL /*static, unused*/, L_32, L_33, /*hidden argument*/NULL);
- V_7 = L_34;
- ObjectTranslator_t2020767555 * L_35 = V_0;
- intptr_t L_36 = ___L0;
- ResourceRequest_t3109103591 * L_37 = V_7;
- NullCheck(L_35);
- ObjectTranslator_Push_m105918116(L_35, L_36, L_37, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00e9;
- }
- IL_00bd:
- {
- goto IL_00dd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c2;
- throw e;
- }
- CATCH_00c2:
- { // begin catch(System.Exception)
- V_8 = ((Exception_t *)__exception_local);
- intptr_t L_38 = ___L0;
- Exception_t * L_39 = V_8;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_40 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_39, /*hidden argument*/NULL);
- int32_t L_41 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_38, L_40, /*hidden argument*/NULL);
- V_4 = L_41;
- goto IL_00e9;
- } // end catch (depth: 1)
- IL_00dd:
- {
- intptr_t L_42 = ___L0;
- int32_t L_43 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_42, _stringLiteral153056392, /*hidden argument*/NULL);
- return L_43;
- }
- IL_00e9:
- {
- int32_t L_44 = V_4;
- return L_44;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_LoadAll_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_LoadAll_xlua_st__m1913279462_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- int32_t V_1 = 0;
- String_t* V_2 = NULL;
- ObjectU5BU5D_t1417781964* V_3 = NULL;
- int32_t V_4 = 0;
- String_t* V_5 = NULL;
- Type_t * V_6 = NULL;
- ObjectU5BU5D_t1417781964* V_7 = NULL;
- Exception_t * V_8 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- int32_t L_5 = V_1;
- if ((!(((uint32_t)L_5) == ((uint32_t)1))))
- {
- goto IL_0052;
- }
- }
- IL_001a:
- {
- intptr_t L_6 = ___L0;
- bool L_7 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_6, 1, /*hidden argument*/NULL);
- if (L_7)
- {
- goto IL_0033;
- }
- }
- IL_0026:
- {
- intptr_t L_8 = ___L0;
- int32_t L_9 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_8, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_9) == ((uint32_t)4))))
- {
- goto IL_0052;
- }
- }
- IL_0033:
- {
- intptr_t L_10 = ___L0;
- String_t* L_11 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_10, 1, /*hidden argument*/NULL);
- V_2 = L_11;
- String_t* L_12 = V_2;
- ObjectU5BU5D_t1417781964* L_13 = Resources_LoadAll_m2792647427(NULL /*static, unused*/, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- ObjectU5BU5D_t1417781964* L_16 = V_3;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, (RuntimeObject *)(RuntimeObject *)L_16, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00e9;
- }
- IL_0052:
- {
- int32_t L_17 = V_1;
- if ((!(((uint32_t)L_17) == ((uint32_t)2))))
- {
- goto IL_00bd;
- }
- }
- IL_0059:
- {
- intptr_t L_18 = ___L0;
- bool L_19 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_18, 1, /*hidden argument*/NULL);
- if (L_19)
- {
- goto IL_0072;
- }
- }
- IL_0065:
- {
- intptr_t L_20 = ___L0;
- int32_t L_21 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_20, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_21) == ((uint32_t)4))))
- {
- goto IL_00bd;
- }
- }
- IL_0072:
- {
- ObjectTranslator_t2020767555 * L_22 = V_0;
- intptr_t L_23 = ___L0;
- NullCheck(L_22);
- bool L_24 = ObjectTranslator_Assignable_TisType_t_m2942600910(L_22, L_23, 2, /*hidden argument*/ObjectTranslator_Assignable_TisType_t_m2942600910_RuntimeMethod_var);
- if (!L_24)
- {
- goto IL_00bd;
- }
- }
- IL_007f:
- {
- intptr_t L_25 = ___L0;
- String_t* L_26 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_25, 1, /*hidden argument*/NULL);
- V_5 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- RuntimeTypeHandle_t3027515415 L_29 = { reinterpret_cast<intptr_t> (Type_t_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_30 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_29, /*hidden argument*/NULL);
- NullCheck(L_27);
- RuntimeObject * L_31 = ObjectTranslator_GetObject_m805173647(L_27, L_28, 2, L_30, /*hidden argument*/NULL);
- V_6 = ((Type_t *)CastclassClass((RuntimeObject*)L_31, Type_t_il2cpp_TypeInfo_var));
- String_t* L_32 = V_5;
- Type_t * L_33 = V_6;
- ObjectU5BU5D_t1417781964* L_34 = Resources_LoadAll_m1574480108(NULL /*static, unused*/, L_32, L_33, /*hidden argument*/NULL);
- V_7 = L_34;
- ObjectTranslator_t2020767555 * L_35 = V_0;
- intptr_t L_36 = ___L0;
- ObjectU5BU5D_t1417781964* L_37 = V_7;
- NullCheck(L_35);
- ObjectTranslator_Push_m105918116(L_35, L_36, (RuntimeObject *)(RuntimeObject *)L_37, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00e9;
- }
- IL_00bd:
- {
- goto IL_00dd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c2;
- throw e;
- }
- CATCH_00c2:
- { // begin catch(System.Exception)
- V_8 = ((Exception_t *)__exception_local);
- intptr_t L_38 = ___L0;
- Exception_t * L_39 = V_8;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_40 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_39, /*hidden argument*/NULL);
- int32_t L_41 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_38, L_40, /*hidden argument*/NULL);
- V_4 = L_41;
- goto IL_00e9;
- } // end catch (depth: 1)
- IL_00dd:
- {
- intptr_t L_42 = ___L0;
- int32_t L_43 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_42, _stringLiteral3187571305, /*hidden argument*/NULL);
- return L_43;
- }
- IL_00e9:
- {
- int32_t L_44 = V_4;
- return L_44;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_GetBuiltinResource_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_GetBuiltinResource_xlua_st__m3144970884_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- String_t* V_2 = NULL;
- Object_t631007953 * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- RuntimeTypeHandle_t3027515415 L_5 = { reinterpret_cast<intptr_t> (Type_t_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_6 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_5, /*hidden argument*/NULL);
- NullCheck(L_3);
- RuntimeObject * L_7 = ObjectTranslator_GetObject_m805173647(L_3, L_4, 1, L_6, /*hidden argument*/NULL);
- V_1 = ((Type_t *)CastclassClass((RuntimeObject*)L_7, Type_t_il2cpp_TypeInfo_var));
- intptr_t L_8 = ___L0;
- String_t* L_9 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_8, 2, /*hidden argument*/NULL);
- V_2 = L_9;
- Type_t * L_10 = V_1;
- String_t* L_11 = V_2;
- Object_t631007953 * L_12 = Resources_GetBuiltinResource_m3641967638(NULL /*static, unused*/, L_10, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- ObjectTranslator_t2020767555 * L_13 = V_0;
- intptr_t L_14 = ___L0;
- Object_t631007953 * L_15 = V_3;
- NullCheck(L_13);
- ObjectTranslator_Push_m105918116(L_13, L_14, L_15, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_005f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0044;
- throw e;
- }
- CATCH_0044:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_4 = L_19;
- goto IL_005f;
- } // end catch (depth: 1)
- IL_005f:
- {
- int32_t L_20 = V_4;
- return L_20;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_UnloadAsset_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_UnloadAsset_xlua_st__m30055910_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Object_t631007953 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- RuntimeTypeHandle_t3027515415 L_5 = { reinterpret_cast<intptr_t> (Object_t631007953_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_6 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_5, /*hidden argument*/NULL);
- NullCheck(L_3);
- RuntimeObject * L_7 = ObjectTranslator_GetObject_m805173647(L_3, L_4, 1, L_6, /*hidden argument*/NULL);
- V_1 = ((Object_t631007953 *)CastclassClass((RuntimeObject*)L_7, Object_t631007953_il2cpp_TypeInfo_var));
- Object_t631007953 * L_8 = V_1;
- Resources_UnloadAsset_m4120664229(NULL /*static, unused*/, L_8, /*hidden argument*/NULL);
- V_2 = 0;
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0031;
- throw e;
- }
- CATCH_0031:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_2 = L_12;
- goto IL_0049;
- } // end catch (depth: 1)
- IL_0049:
- {
- int32_t L_13 = V_2;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineResourcesWrap::_m_UnloadUnusedAssets_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineResourcesWrap__m_UnloadUnusedAssets_xlua_st__m1449106821_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- AsyncOperation_t1445031843 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- AsyncOperation_t1445031843 * L_3 = Resources_UnloadUnusedAssets_m2836736321(NULL /*static, unused*/, /*hidden argument*/NULL);
- V_1 = L_3;
- ObjectTranslator_t2020767555 * L_4 = V_0;
- intptr_t L_5 = ___L0;
- AsyncOperation_t1445031843 * L_6 = V_1;
- NullCheck(L_4);
- ObjectTranslator_Push_m105918116(L_4, L_5, L_6, /*hidden argument*/NULL);
- V_2 = 1;
- goto IL_0039;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0021;
- throw e;
- }
- CATCH_0021:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_2 = L_10;
- goto IL_0039;
- } // end catch (depth: 1)
- IL_0039:
- {
- int32_t L_11 = V_2;
- return L_11;
- }
- }
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815(NULL, ___L0, NULL);
- return returnValue;
- }
- // System.Void XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineSkinnedMeshRendererWrap__ctor_m1861063289 (UnityEngineSkinnedMeshRendererWrap_t4180069450 * __this, const RuntimeMethod* method)
- {
- {
- Object__ctor_m297566312(__this, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Void XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::__Register(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineSkinnedMeshRendererWrap___Register_m3321147875 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap___Register_m3321147875_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- String_t* G_B2_0 = NULL;
- int32_t G_B2_1 = 0;
- intptr_t G_B2_2;
- memset(&G_B2_2, 0, sizeof(G_B2_2));
- String_t* G_B1_0 = NULL;
- int32_t G_B1_1 = 0;
- intptr_t G_B1_2;
- memset(&G_B1_2, 0, sizeof(G_B1_2));
- String_t* G_B4_0 = NULL;
- int32_t G_B4_1 = 0;
- intptr_t G_B4_2;
- memset(&G_B4_2, 0, sizeof(G_B4_2));
- String_t* G_B3_0 = NULL;
- int32_t G_B3_1 = 0;
- intptr_t G_B3_2;
- memset(&G_B3_2, 0, sizeof(G_B3_2));
- String_t* G_B6_0 = NULL;
- int32_t G_B6_1 = 0;
- intptr_t G_B6_2;
- memset(&G_B6_2, 0, sizeof(G_B6_2));
- String_t* G_B5_0 = NULL;
- int32_t G_B5_1 = 0;
- intptr_t G_B5_2;
- memset(&G_B5_2, 0, sizeof(G_B5_2));
- String_t* G_B8_0 = NULL;
- int32_t G_B8_1 = 0;
- intptr_t G_B8_2;
- memset(&G_B8_2, 0, sizeof(G_B8_2));
- String_t* G_B7_0 = NULL;
- int32_t G_B7_1 = 0;
- intptr_t G_B7_2;
- memset(&G_B7_2, 0, sizeof(G_B7_2));
- String_t* G_B10_0 = NULL;
- int32_t G_B10_1 = 0;
- intptr_t G_B10_2;
- memset(&G_B10_2, 0, sizeof(G_B10_2));
- String_t* G_B9_0 = NULL;
- int32_t G_B9_1 = 0;
- intptr_t G_B9_2;
- memset(&G_B9_2, 0, sizeof(G_B9_2));
- String_t* G_B12_0 = NULL;
- int32_t G_B12_1 = 0;
- intptr_t G_B12_2;
- memset(&G_B12_2, 0, sizeof(G_B12_2));
- String_t* G_B11_0 = NULL;
- int32_t G_B11_1 = 0;
- intptr_t G_B11_2;
- memset(&G_B11_2, 0, sizeof(G_B11_2));
- String_t* G_B14_0 = NULL;
- int32_t G_B14_1 = 0;
- intptr_t G_B14_2;
- memset(&G_B14_2, 0, sizeof(G_B14_2));
- String_t* G_B13_0 = NULL;
- int32_t G_B13_1 = 0;
- intptr_t G_B13_2;
- memset(&G_B13_2, 0, sizeof(G_B13_2));
- String_t* G_B16_0 = NULL;
- int32_t G_B16_1 = 0;
- intptr_t G_B16_2;
- memset(&G_B16_2, 0, sizeof(G_B16_2));
- String_t* G_B15_0 = NULL;
- int32_t G_B15_1 = 0;
- intptr_t G_B15_2;
- memset(&G_B15_2, 0, sizeof(G_B15_2));
- String_t* G_B18_0 = NULL;
- int32_t G_B18_1 = 0;
- intptr_t G_B18_2;
- memset(&G_B18_2, 0, sizeof(G_B18_2));
- String_t* G_B17_0 = NULL;
- int32_t G_B17_1 = 0;
- intptr_t G_B17_2;
- memset(&G_B17_2, 0, sizeof(G_B17_2));
- String_t* G_B20_0 = NULL;
- int32_t G_B20_1 = 0;
- intptr_t G_B20_2;
- memset(&G_B20_2, 0, sizeof(G_B20_2));
- String_t* G_B19_0 = NULL;
- int32_t G_B19_1 = 0;
- intptr_t G_B19_2;
- memset(&G_B19_2, 0, sizeof(G_B19_2));
- String_t* G_B22_0 = NULL;
- int32_t G_B22_1 = 0;
- intptr_t G_B22_2;
- memset(&G_B22_2, 0, sizeof(G_B22_2));
- String_t* G_B21_0 = NULL;
- int32_t G_B21_1 = 0;
- intptr_t G_B21_2;
- memset(&G_B21_2, 0, sizeof(G_B21_2));
- String_t* G_B24_0 = NULL;
- int32_t G_B24_1 = 0;
- intptr_t G_B24_2;
- memset(&G_B24_2, 0, sizeof(G_B24_2));
- String_t* G_B23_0 = NULL;
- int32_t G_B23_1 = 0;
- intptr_t G_B23_2;
- memset(&G_B23_2, 0, sizeof(G_B23_2));
- String_t* G_B26_0 = NULL;
- int32_t G_B26_1 = 0;
- intptr_t G_B26_2;
- memset(&G_B26_2, 0, sizeof(G_B26_2));
- String_t* G_B25_0 = NULL;
- int32_t G_B25_1 = 0;
- intptr_t G_B25_2;
- memset(&G_B25_2, 0, sizeof(G_B25_2));
- String_t* G_B28_0 = NULL;
- int32_t G_B28_1 = 0;
- intptr_t G_B28_2;
- memset(&G_B28_2, 0, sizeof(G_B28_2));
- String_t* G_B27_0 = NULL;
- int32_t G_B27_1 = 0;
- intptr_t G_B27_2;
- memset(&G_B27_2, 0, sizeof(G_B27_2));
- String_t* G_B30_0 = NULL;
- int32_t G_B30_1 = 0;
- intptr_t G_B30_2;
- memset(&G_B30_2, 0, sizeof(G_B30_2));
- String_t* G_B29_0 = NULL;
- int32_t G_B29_1 = 0;
- intptr_t G_B29_2;
- memset(&G_B29_2, 0, sizeof(G_B29_2));
- String_t* G_B32_0 = NULL;
- int32_t G_B32_1 = 0;
- intptr_t G_B32_2;
- memset(&G_B32_2, 0, sizeof(G_B32_2));
- String_t* G_B31_0 = NULL;
- int32_t G_B31_1 = 0;
- intptr_t G_B31_2;
- memset(&G_B31_2, 0, sizeof(G_B31_2));
- String_t* G_B34_0 = NULL;
- int32_t G_B34_1 = 0;
- intptr_t G_B34_2;
- memset(&G_B34_2, 0, sizeof(G_B34_2));
- String_t* G_B33_0 = NULL;
- int32_t G_B33_1 = 0;
- intptr_t G_B33_2;
- memset(&G_B33_2, 0, sizeof(G_B33_2));
- intptr_t G_B36_0;
- memset(&G_B36_0, 0, sizeof(G_B36_0));
- Type_t * G_B36_1 = NULL;
- intptr_t G_B35_0;
- memset(&G_B35_0, 0, sizeof(G_B35_0));
- Type_t * G_B35_1 = NULL;
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- RuntimeTypeHandle_t3027515415 L_3 = { reinterpret_cast<intptr_t> (SkinnedMeshRenderer_t245602842_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_4 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- Type_t * L_5 = V_1;
- intptr_t L_6 = ___L0;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- Utils_BeginObjectRegister_m972381667(NULL /*static, unused*/, L_5, L_6, L_7, 0, 3, 7, 7, (-1), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- lua_CSFunction_t883524059 * L_9 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- G_B1_0 = _stringLiteral2598379935;
- G_B1_1 = ((int32_t)-3);
- G_B1_2 = L_8;
- if (L_9)
- {
- G_B2_0 = _stringLiteral2598379935;
- G_B2_1 = ((int32_t)-3);
- G_B2_2 = L_8;
- goto IL_0044;
- }
- }
- {
- intptr_t L_10 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_11 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_11, NULL, L_10, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache0_0(L_11);
- G_B2_0 = G_B1_0;
- G_B2_1 = G_B1_1;
- G_B2_2 = G_B1_2;
- }
- IL_0044:
- {
- lua_CSFunction_t883524059 * L_12 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B2_2, G_B2_1, G_B2_0, L_12, /*hidden argument*/NULL);
- intptr_t L_13 = ___L0;
- lua_CSFunction_t883524059 * L_14 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- G_B3_0 = _stringLiteral2438723531;
- G_B3_1 = ((int32_t)-3);
- G_B3_2 = L_13;
- if (L_14)
- {
- G_B4_0 = _stringLiteral2438723531;
- G_B4_1 = ((int32_t)-3);
- G_B4_2 = L_13;
- goto IL_006e;
- }
- }
- {
- intptr_t L_15 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_16 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_16, NULL, L_15, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1_1(L_16);
- G_B4_0 = G_B3_0;
- G_B4_1 = G_B3_1;
- G_B4_2 = G_B3_2;
- }
- IL_006e:
- {
- lua_CSFunction_t883524059 * L_17 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B4_2, G_B4_1, G_B4_0, L_17, /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- lua_CSFunction_t883524059 * L_19 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- G_B5_0 = _stringLiteral2666589067;
- G_B5_1 = ((int32_t)-3);
- G_B5_2 = L_18;
- if (L_19)
- {
- G_B6_0 = _stringLiteral2666589067;
- G_B6_1 = ((int32_t)-3);
- G_B6_2 = L_18;
- goto IL_0098;
- }
- }
- {
- intptr_t L_20 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_21 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_21, NULL, L_20, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2_2(L_21);
- G_B6_0 = G_B5_0;
- G_B6_1 = G_B5_1;
- G_B6_2 = G_B5_2;
- }
- IL_0098:
- {
- lua_CSFunction_t883524059 * L_22 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B6_2, G_B6_1, G_B6_0, L_22, /*hidden argument*/NULL);
- intptr_t L_23 = ___L0;
- lua_CSFunction_t883524059 * L_24 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- G_B7_0 = _stringLiteral1602046325;
- G_B7_1 = ((int32_t)-2);
- G_B7_2 = L_23;
- if (L_24)
- {
- G_B8_0 = _stringLiteral1602046325;
- G_B8_1 = ((int32_t)-2);
- G_B8_2 = L_23;
- goto IL_00c2;
- }
- }
- {
- intptr_t L_25 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_26 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_26, NULL, L_25, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3_3(L_26);
- G_B8_0 = G_B7_0;
- G_B8_1 = G_B7_1;
- G_B8_2 = G_B7_2;
- }
- IL_00c2:
- {
- lua_CSFunction_t883524059 * L_27 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B8_2, G_B8_1, G_B8_0, L_27, /*hidden argument*/NULL);
- intptr_t L_28 = ___L0;
- lua_CSFunction_t883524059 * L_29 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- G_B9_0 = _stringLiteral168267742;
- G_B9_1 = ((int32_t)-2);
- G_B9_2 = L_28;
- if (L_29)
- {
- G_B10_0 = _stringLiteral168267742;
- G_B10_1 = ((int32_t)-2);
- G_B10_2 = L_28;
- goto IL_00ec;
- }
- }
- {
- intptr_t L_30 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_31 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_31, NULL, L_30, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4_4(L_31);
- G_B10_0 = G_B9_0;
- G_B10_1 = G_B9_1;
- G_B10_2 = G_B9_2;
- }
- IL_00ec:
- {
- lua_CSFunction_t883524059 * L_32 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B10_2, G_B10_1, G_B10_0, L_32, /*hidden argument*/NULL);
- intptr_t L_33 = ___L0;
- lua_CSFunction_t883524059 * L_34 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- G_B11_0 = _stringLiteral2598687286;
- G_B11_1 = ((int32_t)-2);
- G_B11_2 = L_33;
- if (L_34)
- {
- G_B12_0 = _stringLiteral2598687286;
- G_B12_1 = ((int32_t)-2);
- G_B12_2 = L_33;
- goto IL_0116;
- }
- }
- {
- intptr_t L_35 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_36 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_36, NULL, L_35, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache5_5(L_36);
- G_B12_0 = G_B11_0;
- G_B12_1 = G_B11_1;
- G_B12_2 = G_B11_2;
- }
- IL_0116:
- {
- lua_CSFunction_t883524059 * L_37 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B12_2, G_B12_1, G_B12_0, L_37, /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- lua_CSFunction_t883524059 * L_39 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- G_B13_0 = _stringLiteral437393465;
- G_B13_1 = ((int32_t)-2);
- G_B13_2 = L_38;
- if (L_39)
- {
- G_B14_0 = _stringLiteral437393465;
- G_B14_1 = ((int32_t)-2);
- G_B14_2 = L_38;
- goto IL_0140;
- }
- }
- {
- intptr_t L_40 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_41 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_41, NULL, L_40, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache6_6(L_41);
- G_B14_0 = G_B13_0;
- G_B14_1 = G_B13_1;
- G_B14_2 = G_B13_2;
- }
- IL_0140:
- {
- lua_CSFunction_t883524059 * L_42 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B14_2, G_B14_1, G_B14_0, L_42, /*hidden argument*/NULL);
- intptr_t L_43 = ___L0;
- lua_CSFunction_t883524059 * L_44 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- G_B15_0 = _stringLiteral1549634244;
- G_B15_1 = ((int32_t)-2);
- G_B15_2 = L_43;
- if (L_44)
- {
- G_B16_0 = _stringLiteral1549634244;
- G_B16_1 = ((int32_t)-2);
- G_B16_2 = L_43;
- goto IL_016a;
- }
- }
- {
- intptr_t L_45 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_46 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_46, NULL, L_45, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache7_7(L_46);
- G_B16_0 = G_B15_0;
- G_B16_1 = G_B15_1;
- G_B16_2 = G_B15_2;
- }
- IL_016a:
- {
- lua_CSFunction_t883524059 * L_47 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B16_2, G_B16_1, G_B16_0, L_47, /*hidden argument*/NULL);
- intptr_t L_48 = ___L0;
- lua_CSFunction_t883524059 * L_49 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- G_B17_0 = _stringLiteral893705022;
- G_B17_1 = ((int32_t)-2);
- G_B17_2 = L_48;
- if (L_49)
- {
- G_B18_0 = _stringLiteral893705022;
- G_B18_1 = ((int32_t)-2);
- G_B18_2 = L_48;
- goto IL_0194;
- }
- }
- {
- intptr_t L_50 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_51 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_51, NULL, L_50, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache8_8(L_51);
- G_B18_0 = G_B17_0;
- G_B18_1 = G_B17_1;
- G_B18_2 = G_B17_2;
- }
- IL_0194:
- {
- lua_CSFunction_t883524059 * L_52 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B18_2, G_B18_1, G_B18_0, L_52, /*hidden argument*/NULL);
- intptr_t L_53 = ___L0;
- lua_CSFunction_t883524059 * L_54 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- G_B19_0 = _stringLiteral3076283689;
- G_B19_1 = ((int32_t)-2);
- G_B19_2 = L_53;
- if (L_54)
- {
- G_B20_0 = _stringLiteral3076283689;
- G_B20_1 = ((int32_t)-2);
- G_B20_2 = L_53;
- goto IL_01be;
- }
- }
- {
- intptr_t L_55 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_56 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_56, NULL, L_55, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache9_9(L_56);
- G_B20_0 = G_B19_0;
- G_B20_1 = G_B19_1;
- G_B20_2 = G_B19_2;
- }
- IL_01be:
- {
- lua_CSFunction_t883524059 * L_57 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B20_2, G_B20_1, G_B20_0, L_57, /*hidden argument*/NULL);
- intptr_t L_58 = ___L0;
- lua_CSFunction_t883524059 * L_59 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- G_B21_0 = _stringLiteral1602046325;
- G_B21_1 = (-1);
- G_B21_2 = L_58;
- if (L_59)
- {
- G_B22_0 = _stringLiteral1602046325;
- G_B22_1 = (-1);
- G_B22_2 = L_58;
- goto IL_01e7;
- }
- }
- {
- intptr_t L_60 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_61 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_61, NULL, L_60, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheA_10(L_61);
- G_B22_0 = G_B21_0;
- G_B22_1 = G_B21_1;
- G_B22_2 = G_B21_2;
- }
- IL_01e7:
- {
- lua_CSFunction_t883524059 * L_62 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B22_2, G_B22_1, G_B22_0, L_62, /*hidden argument*/NULL);
- intptr_t L_63 = ___L0;
- lua_CSFunction_t883524059 * L_64 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- G_B23_0 = _stringLiteral168267742;
- G_B23_1 = (-1);
- G_B23_2 = L_63;
- if (L_64)
- {
- G_B24_0 = _stringLiteral168267742;
- G_B24_1 = (-1);
- G_B24_2 = L_63;
- goto IL_0210;
- }
- }
- {
- intptr_t L_65 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_66 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_66, NULL, L_65, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheB_11(L_66);
- G_B24_0 = G_B23_0;
- G_B24_1 = G_B23_1;
- G_B24_2 = G_B23_2;
- }
- IL_0210:
- {
- lua_CSFunction_t883524059 * L_67 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B24_2, G_B24_1, G_B24_0, L_67, /*hidden argument*/NULL);
- intptr_t L_68 = ___L0;
- lua_CSFunction_t883524059 * L_69 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- G_B25_0 = _stringLiteral2598687286;
- G_B25_1 = (-1);
- G_B25_2 = L_68;
- if (L_69)
- {
- G_B26_0 = _stringLiteral2598687286;
- G_B26_1 = (-1);
- G_B26_2 = L_68;
- goto IL_0239;
- }
- }
- {
- intptr_t L_70 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_71 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_71, NULL, L_70, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheC_12(L_71);
- G_B26_0 = G_B25_0;
- G_B26_1 = G_B25_1;
- G_B26_2 = G_B25_2;
- }
- IL_0239:
- {
- lua_CSFunction_t883524059 * L_72 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B26_2, G_B26_1, G_B26_0, L_72, /*hidden argument*/NULL);
- intptr_t L_73 = ___L0;
- lua_CSFunction_t883524059 * L_74 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- G_B27_0 = _stringLiteral437393465;
- G_B27_1 = (-1);
- G_B27_2 = L_73;
- if (L_74)
- {
- G_B28_0 = _stringLiteral437393465;
- G_B28_1 = (-1);
- G_B28_2 = L_73;
- goto IL_0262;
- }
- }
- {
- intptr_t L_75 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_76 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_76, NULL, L_75, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheD_13(L_76);
- G_B28_0 = G_B27_0;
- G_B28_1 = G_B27_1;
- G_B28_2 = G_B27_2;
- }
- IL_0262:
- {
- lua_CSFunction_t883524059 * L_77 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B28_2, G_B28_1, G_B28_0, L_77, /*hidden argument*/NULL);
- intptr_t L_78 = ___L0;
- lua_CSFunction_t883524059 * L_79 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- G_B29_0 = _stringLiteral1549634244;
- G_B29_1 = (-1);
- G_B29_2 = L_78;
- if (L_79)
- {
- G_B30_0 = _stringLiteral1549634244;
- G_B30_1 = (-1);
- G_B30_2 = L_78;
- goto IL_028b;
- }
- }
- {
- intptr_t L_80 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_81 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_81, NULL, L_80, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheE_14(L_81);
- G_B30_0 = G_B29_0;
- G_B30_1 = G_B29_1;
- G_B30_2 = G_B29_2;
- }
- IL_028b:
- {
- lua_CSFunction_t883524059 * L_82 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B30_2, G_B30_1, G_B30_0, L_82, /*hidden argument*/NULL);
- intptr_t L_83 = ___L0;
- lua_CSFunction_t883524059 * L_84 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- G_B31_0 = _stringLiteral893705022;
- G_B31_1 = (-1);
- G_B31_2 = L_83;
- if (L_84)
- {
- G_B32_0 = _stringLiteral893705022;
- G_B32_1 = (-1);
- G_B32_2 = L_83;
- goto IL_02b4;
- }
- }
- {
- intptr_t L_85 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_86 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_86, NULL, L_85, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheF_15(L_86);
- G_B32_0 = G_B31_0;
- G_B32_1 = G_B31_1;
- G_B32_2 = G_B31_2;
- }
- IL_02b4:
- {
- lua_CSFunction_t883524059 * L_87 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B32_2, G_B32_1, G_B32_0, L_87, /*hidden argument*/NULL);
- intptr_t L_88 = ___L0;
- lua_CSFunction_t883524059 * L_89 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- G_B33_0 = _stringLiteral3076283689;
- G_B33_1 = (-1);
- G_B33_2 = L_88;
- if (L_89)
- {
- G_B34_0 = _stringLiteral3076283689;
- G_B34_1 = (-1);
- G_B34_2 = L_88;
- goto IL_02dd;
- }
- }
- {
- intptr_t L_90 = (intptr_t)UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_91 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_91, NULL, L_90, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache10_16(L_91);
- G_B34_0 = G_B33_0;
- G_B34_1 = G_B33_1;
- G_B34_2 = G_B33_2;
- }
- IL_02dd:
- {
- lua_CSFunction_t883524059 * L_92 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B34_2, G_B34_1, G_B34_0, L_92, /*hidden argument*/NULL);
- Type_t * L_93 = V_1;
- intptr_t L_94 = ___L0;
- ObjectTranslator_t2020767555 * L_95 = V_0;
- Utils_EndObjectRegister_m3642684994(NULL /*static, unused*/, L_93, L_94, L_95, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, (Type_t *)NULL, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, /*hidden argument*/NULL);
- Type_t * L_96 = V_1;
- intptr_t L_97 = ___L0;
- lua_CSFunction_t883524059 * L_98 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- G_B35_0 = L_97;
- G_B35_1 = L_96;
- if (L_98)
- {
- G_B36_0 = L_97;
- G_B36_1 = L_96;
- goto IL_030e;
- }
- }
- {
- intptr_t L_99 = (intptr_t)UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_100 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_100, NULL, L_99, /*hidden argument*/NULL);
- ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache11_17(L_100);
- G_B36_0 = G_B35_0;
- G_B36_1 = G_B35_1;
- }
- IL_030e:
- {
- lua_CSFunction_t883524059 * L_101 = ((UnityEngineSkinnedMeshRendererWrap_t4180069450_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineSkinnedMeshRendererWrap_t4180069450_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- Utils_BeginClassRegister_m3630094254(NULL /*static, unused*/, G_B36_1, G_B36_0, L_101, 1, 0, 0, /*hidden argument*/NULL);
- Type_t * L_102 = V_1;
- intptr_t L_103 = ___L0;
- ObjectTranslator_t2020767555 * L_104 = V_0;
- Utils_EndClassRegister_m1460189367(NULL /*static, unused*/, L_102, L_103, L_104, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap___CreateInstance_m4243544182_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_4) == ((uint32_t)1))))
- {
- goto IL_002d;
- }
- }
- IL_0018:
- {
- SkinnedMeshRenderer_t245602842 * L_5 = (SkinnedMeshRenderer_t245602842 *)il2cpp_codegen_object_new(SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var);
- SkinnedMeshRenderer__ctor_m3041302873(L_5, /*hidden argument*/NULL);
- V_1 = L_5;
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_8, /*hidden argument*/NULL);
- V_2 = 1;
- goto IL_0056;
- }
- IL_002d:
- {
- goto IL_004a;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0032;
- throw e;
- }
- CATCH_0032:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_2 = L_12;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_004a:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, _stringLiteral3094264994, /*hidden argument*/NULL);
- return L_14;
- }
- IL_0056:
- {
- int32_t L_15 = V_2;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_m_GetBlendShapeWeight(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__m_GetBlendShapeWeight_m403826143_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = L_7;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- int32_t L_9 = V_2;
- NullCheck(L_8);
- float L_10 = SkinnedMeshRenderer_GetBlendShapeWeight_m2096074612(L_8, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- intptr_t L_11 = ___L0;
- float L_12 = V_3;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_11, (((double)((double)L_12))), /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0055;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003a;
- throw e;
- }
- CATCH_003a:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0055;
- } // end catch (depth: 1)
- IL_0055:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_m_SetBlendShapeWeight(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__m_SetBlendShapeWeight_m4031683963_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = L_7;
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- SkinnedMeshRenderer_t245602842 * L_10 = V_1;
- int32_t L_11 = V_2;
- float L_12 = V_3;
- NullCheck(L_10);
- SkinnedMeshRenderer_SetBlendShapeWeight_m3755486032(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_0056;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003b;
- throw e;
- }
- CATCH_003b:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_0056:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_m_BakeMesh(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__m_BakeMesh_m467360101_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Mesh_t3648964284 * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- RuntimeTypeHandle_t3027515415 L_8 = { reinterpret_cast<intptr_t> (Mesh_t3648964284_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_9 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- RuntimeObject * L_10 = ObjectTranslator_GetObject_m805173647(L_6, L_7, 2, L_9, /*hidden argument*/NULL);
- V_2 = ((Mesh_t3648964284 *)CastclassSealed((RuntimeObject*)L_10, Mesh_t3648964284_il2cpp_TypeInfo_var));
- SkinnedMeshRenderer_t245602842 * L_11 = V_1;
- Mesh_t3648964284 * L_12 = V_2;
- NullCheck(L_11);
- SkinnedMeshRenderer_BakeMesh_m2270373039(L_11, L_12, /*hidden argument*/NULL);
- V_3 = 0;
- goto IL_005a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0040;
- throw e;
- }
- CATCH_0040:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_3 = L_16;
- goto IL_005a;
- } // end catch (depth: 1)
- IL_005a:
- {
- int32_t L_17 = V_3;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_bones(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_bones_m2089754439_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- NullCheck(L_8);
- TransformU5BU5D_t807237628* L_9 = SkinnedMeshRenderer_get_bones_m333719399(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, (RuntimeObject *)(RuntimeObject *)L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_quality(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_quality_m1660502229_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- NullCheck(L_8);
- int32_t L_9 = SkinnedMeshRenderer_get_quality_m2793860528(L_8, /*hidden argument*/NULL);
- int32_t L_10 = L_9;
- RuntimeObject * L_11 = Box(SkinQuality_t4231844520_il2cpp_TypeInfo_var, &L_10);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_11, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0031;
- throw e;
- }
- CATCH_0031:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 1;
- }
- IL_004b:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_updateWhenOffscreen(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_updateWhenOffscreen_m208726724_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_7 = V_1;
- NullCheck(L_7);
- bool L_8 = SkinnedMeshRenderer_get_updateWhenOffscreen_m322274263(L_7, /*hidden argument*/NULL);
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_rootBone(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_rootBone_m3992627656_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- NullCheck(L_8);
- Transform_t3600365921 * L_9 = SkinnedMeshRenderer_get_rootBone_m1530334984(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_sharedMesh(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_sharedMesh_m2763817459_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- NullCheck(L_8);
- Mesh_t3648964284 * L_9 = SkinnedMeshRenderer_get_sharedMesh_m1611698282(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_skinnedMotionVectors(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_skinnedMotionVectors_m3661836286_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_7 = V_1;
- NullCheck(L_7);
- bool L_8 = SkinnedMeshRenderer_get_skinnedMotionVectors_m1202820987(L_7, /*hidden argument*/NULL);
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_g_get_localBounds(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__g_get_localBounds_m4085540027_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- NullCheck(L_8);
- Bounds_t2266837910 L_9 = SkinnedMeshRenderer_get_localBounds_m2798545833(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineBounds_m1034727825(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_bones(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_bones_m1883874353_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- SkinnedMeshRenderer_t245602842 * L_6 = V_1;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- RuntimeTypeHandle_t3027515415 L_9 = { reinterpret_cast<intptr_t> (TransformU5BU5D_t807237628_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_10 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_9, /*hidden argument*/NULL);
- NullCheck(L_7);
- RuntimeObject * L_11 = ObjectTranslator_GetObject_m805173647(L_7, L_8, 2, L_10, /*hidden argument*/NULL);
- NullCheck(L_6);
- SkinnedMeshRenderer_set_bones_m4136734710(L_6, ((TransformU5BU5D_t807237628*)Castclass((RuntimeObject*)L_11, TransformU5BU5D_t807237628_il2cpp_TypeInfo_var)), /*hidden argument*/NULL);
- goto IL_0054;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003c;
- throw e;
- }
- CATCH_003c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_0054:
- {
- return 0;
- }
- IL_0056:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_quality(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_quality_m3503841796_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_TisSkinQuality_t4231844520_m2385978519(L_6, L_7, 2, (&V_2), /*hidden argument*/ObjectTranslator_Get_TisSkinQuality_t4231844520_m2385978519_RuntimeMethod_var);
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- int32_t L_9 = V_2;
- NullCheck(L_8);
- SkinnedMeshRenderer_set_quality_m699927355(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_updateWhenOffscreen(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_updateWhenOffscreen_m629109567_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- SkinnedMeshRenderer_t245602842 * L_6 = V_1;
- intptr_t L_7 = ___L0;
- bool L_8 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_7, 2, /*hidden argument*/NULL);
- NullCheck(L_6);
- SkinnedMeshRenderer_set_updateWhenOffscreen_m3087825351(L_6, L_8, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 0;
- }
- IL_0046:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_rootBone(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_rootBone_m3511354043_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- SkinnedMeshRenderer_t245602842 * L_6 = V_1;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- RuntimeTypeHandle_t3027515415 L_9 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_10 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_9, /*hidden argument*/NULL);
- NullCheck(L_7);
- RuntimeObject * L_11 = ObjectTranslator_GetObject_m805173647(L_7, L_8, 2, L_10, /*hidden argument*/NULL);
- NullCheck(L_6);
- SkinnedMeshRenderer_set_rootBone_m4271355631(L_6, ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_11, Transform_t3600365921_il2cpp_TypeInfo_var)), /*hidden argument*/NULL);
- goto IL_0054;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003c;
- throw e;
- }
- CATCH_003c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_0054:
- {
- return 0;
- }
- IL_0056:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_sharedMesh(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_sharedMesh_m2856948942_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- SkinnedMeshRenderer_t245602842 * L_6 = V_1;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- RuntimeTypeHandle_t3027515415 L_9 = { reinterpret_cast<intptr_t> (Mesh_t3648964284_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_10 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_9, /*hidden argument*/NULL);
- NullCheck(L_7);
- RuntimeObject * L_11 = ObjectTranslator_GetObject_m805173647(L_7, L_8, 2, L_10, /*hidden argument*/NULL);
- NullCheck(L_6);
- SkinnedMeshRenderer_set_sharedMesh_m2397334786(L_6, ((Mesh_t3648964284 *)CastclassSealed((RuntimeObject*)L_11, Mesh_t3648964284_il2cpp_TypeInfo_var)), /*hidden argument*/NULL);
- goto IL_0054;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003c;
- throw e;
- }
- CATCH_003c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_0054:
- {
- return 0;
- }
- IL_0056:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_skinnedMotionVectors(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_skinnedMotionVectors_m1824021720_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- SkinnedMeshRenderer_t245602842 * L_6 = V_1;
- intptr_t L_7 = ___L0;
- bool L_8 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_7, 2, /*hidden argument*/NULL);
- NullCheck(L_6);
- SkinnedMeshRenderer_set_skinnedMotionVectors_m3578095715(L_6, L_8, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 0;
- }
- IL_0046:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineSkinnedMeshRendererWrap::_s_set_localBounds(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineSkinnedMeshRendererWrap__s_set_localBounds_m1414557815_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- SkinnedMeshRenderer_t245602842 * V_1 = NULL;
- Bounds_t2266837910 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((SkinnedMeshRenderer_t245602842 *)CastclassClass((RuntimeObject*)L_5, SkinnedMeshRenderer_t245602842_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m4012846247(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- SkinnedMeshRenderer_t245602842 * L_8 = V_1;
- Bounds_t2266837910 L_9 = V_2;
- NullCheck(L_8);
- SkinnedMeshRenderer_set_localBounds_m2847626607(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTextAssetWrap___CreateInstance_m788894500(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTextAssetWrap___CreateInstance_m788894500(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTextAssetWrap__m_ToString_m2000840227(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTextAssetWrap__m_ToString_m2000840227(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTextAssetWrap__g_get_text_m2083243538(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTextAssetWrap__g_get_text_m2083243538(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTextAssetWrap__g_get_bytes_m819075780(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTextAssetWrap__g_get_bytes_m819075780(NULL, ___L0, NULL);
- return returnValue;
- }
- // System.Void XLua.CSObjectWrap.UnityEngineTextAssetWrap::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineTextAssetWrap__ctor_m2732882125 (UnityEngineTextAssetWrap_t3364475192 * __this, const RuntimeMethod* method)
- {
- {
- Object__ctor_m297566312(__this, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Void XLua.CSObjectWrap.UnityEngineTextAssetWrap::__Register(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineTextAssetWrap___Register_m2660327034 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTextAssetWrap___Register_m2660327034_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- String_t* G_B2_0 = NULL;
- int32_t G_B2_1 = 0;
- intptr_t G_B2_2;
- memset(&G_B2_2, 0, sizeof(G_B2_2));
- String_t* G_B1_0 = NULL;
- int32_t G_B1_1 = 0;
- intptr_t G_B1_2;
- memset(&G_B1_2, 0, sizeof(G_B1_2));
- String_t* G_B4_0 = NULL;
- int32_t G_B4_1 = 0;
- intptr_t G_B4_2;
- memset(&G_B4_2, 0, sizeof(G_B4_2));
- String_t* G_B3_0 = NULL;
- int32_t G_B3_1 = 0;
- intptr_t G_B3_2;
- memset(&G_B3_2, 0, sizeof(G_B3_2));
- String_t* G_B6_0 = NULL;
- int32_t G_B6_1 = 0;
- intptr_t G_B6_2;
- memset(&G_B6_2, 0, sizeof(G_B6_2));
- String_t* G_B5_0 = NULL;
- int32_t G_B5_1 = 0;
- intptr_t G_B5_2;
- memset(&G_B5_2, 0, sizeof(G_B5_2));
- intptr_t G_B8_0;
- memset(&G_B8_0, 0, sizeof(G_B8_0));
- Type_t * G_B8_1 = NULL;
- intptr_t G_B7_0;
- memset(&G_B7_0, 0, sizeof(G_B7_0));
- Type_t * G_B7_1 = NULL;
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- RuntimeTypeHandle_t3027515415 L_3 = { reinterpret_cast<intptr_t> (TextAsset_t3022178571_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_4 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- Type_t * L_5 = V_1;
- intptr_t L_6 = ___L0;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- Utils_BeginObjectRegister_m972381667(NULL /*static, unused*/, L_5, L_6, L_7, 0, 1, 2, 0, (-1), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- lua_CSFunction_t883524059 * L_9 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- G_B1_0 = _stringLiteral3020121551;
- G_B1_1 = ((int32_t)-3);
- G_B1_2 = L_8;
- if (L_9)
- {
- G_B2_0 = _stringLiteral3020121551;
- G_B2_1 = ((int32_t)-3);
- G_B2_2 = L_8;
- goto IL_0044;
- }
- }
- {
- intptr_t L_10 = (intptr_t)UnityEngineTextAssetWrap__m_ToString_m2000840227_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_11 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_11, NULL, L_10, /*hidden argument*/NULL);
- ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache0_0(L_11);
- G_B2_0 = G_B1_0;
- G_B2_1 = G_B1_1;
- G_B2_2 = G_B1_2;
- }
- IL_0044:
- {
- lua_CSFunction_t883524059 * L_12 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B2_2, G_B2_1, G_B2_0, L_12, /*hidden argument*/NULL);
- intptr_t L_13 = ___L0;
- lua_CSFunction_t883524059 * L_14 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- G_B3_0 = _stringLiteral3987835854;
- G_B3_1 = ((int32_t)-2);
- G_B3_2 = L_13;
- if (L_14)
- {
- G_B4_0 = _stringLiteral3987835854;
- G_B4_1 = ((int32_t)-2);
- G_B4_2 = L_13;
- goto IL_006e;
- }
- }
- {
- intptr_t L_15 = (intptr_t)UnityEngineTextAssetWrap__g_get_text_m2083243538_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_16 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_16, NULL, L_15, /*hidden argument*/NULL);
- ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1_1(L_16);
- G_B4_0 = G_B3_0;
- G_B4_1 = G_B3_1;
- G_B4_2 = G_B3_2;
- }
- IL_006e:
- {
- lua_CSFunction_t883524059 * L_17 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B4_2, G_B4_1, G_B4_0, L_17, /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- lua_CSFunction_t883524059 * L_19 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- G_B5_0 = _stringLiteral130595687;
- G_B5_1 = ((int32_t)-2);
- G_B5_2 = L_18;
- if (L_19)
- {
- G_B6_0 = _stringLiteral130595687;
- G_B6_1 = ((int32_t)-2);
- G_B6_2 = L_18;
- goto IL_0098;
- }
- }
- {
- intptr_t L_20 = (intptr_t)UnityEngineTextAssetWrap__g_get_bytes_m819075780_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_21 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_21, NULL, L_20, /*hidden argument*/NULL);
- ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2_2(L_21);
- G_B6_0 = G_B5_0;
- G_B6_1 = G_B5_1;
- G_B6_2 = G_B5_2;
- }
- IL_0098:
- {
- lua_CSFunction_t883524059 * L_22 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B6_2, G_B6_1, G_B6_0, L_22, /*hidden argument*/NULL);
- Type_t * L_23 = V_1;
- intptr_t L_24 = ___L0;
- ObjectTranslator_t2020767555 * L_25 = V_0;
- Utils_EndObjectRegister_m3642684994(NULL /*static, unused*/, L_23, L_24, L_25, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, (Type_t *)NULL, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, /*hidden argument*/NULL);
- Type_t * L_26 = V_1;
- intptr_t L_27 = ___L0;
- lua_CSFunction_t883524059 * L_28 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- G_B7_0 = L_27;
- G_B7_1 = L_26;
- if (L_28)
- {
- G_B8_0 = L_27;
- G_B8_1 = L_26;
- goto IL_00c9;
- }
- }
- {
- intptr_t L_29 = (intptr_t)UnityEngineTextAssetWrap___CreateInstance_m788894500_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_30 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_30, NULL, L_29, /*hidden argument*/NULL);
- ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3_3(L_30);
- G_B8_0 = G_B7_0;
- G_B8_1 = G_B7_1;
- }
- IL_00c9:
- {
- lua_CSFunction_t883524059 * L_31 = ((UnityEngineTextAssetWrap_t3364475192_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTextAssetWrap_t3364475192_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- Utils_BeginClassRegister_m3630094254(NULL /*static, unused*/, G_B8_1, G_B8_0, L_31, 1, 0, 0, /*hidden argument*/NULL);
- Type_t * L_32 = V_1;
- intptr_t L_33 = ___L0;
- ObjectTranslator_t2020767555 * L_34 = V_0;
- Utils_EndClassRegister_m1460189367(NULL /*static, unused*/, L_32, L_33, L_34, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap___CreateInstance_m788894500 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTextAssetWrap___CreateInstance_m788894500_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- TextAsset_t3022178571 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_4) == ((uint32_t)1))))
- {
- goto IL_002d;
- }
- }
- IL_0018:
- {
- TextAsset_t3022178571 * L_5 = (TextAsset_t3022178571 *)il2cpp_codegen_object_new(TextAsset_t3022178571_il2cpp_TypeInfo_var);
- TextAsset__ctor_m2405005845(L_5, /*hidden argument*/NULL);
- V_1 = L_5;
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- TextAsset_t3022178571 * L_8 = V_1;
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_8, /*hidden argument*/NULL);
- V_2 = 1;
- goto IL_0056;
- }
- IL_002d:
- {
- goto IL_004a;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0032;
- throw e;
- }
- CATCH_0032:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_2 = L_12;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_004a:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, _stringLiteral851764850, /*hidden argument*/NULL);
- return L_14;
- }
- IL_0056:
- {
- int32_t L_15 = V_2;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::_m_ToString(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap__m_ToString_m2000840227 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTextAssetWrap__m_ToString_m2000840227_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- TextAsset_t3022178571 * V_1 = NULL;
- String_t* V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((TextAsset_t3022178571 *)CastclassClass((RuntimeObject*)L_5, TextAsset_t3022178571_il2cpp_TypeInfo_var));
- TextAsset_t3022178571 * L_6 = V_1;
- NullCheck(L_6);
- String_t* L_7 = VirtFuncInvoker0< String_t* >::Invoke(3 /* System.String System.Object::ToString() */, L_6);
- V_2 = L_7;
- intptr_t L_8 = ___L0;
- String_t* L_9 = V_2;
- Lua_lua_pushstring_m4067524778(NULL /*static, unused*/, L_8, L_9, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002f;
- throw e;
- }
- CATCH_002f:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0049;
- } // end catch (depth: 1)
- IL_0049:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::_g_get_text(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap__g_get_text_m2083243538 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTextAssetWrap__g_get_text_m2083243538_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- TextAsset_t3022178571 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((TextAsset_t3022178571 *)CastclassClass((RuntimeObject*)L_5, TextAsset_t3022178571_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- TextAsset_t3022178571 * L_7 = V_1;
- NullCheck(L_7);
- String_t* L_8 = TextAsset_get_text_m2027878391(L_7, /*hidden argument*/NULL);
- Lua_lua_pushstring_m4067524778(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTextAssetWrap::_g_get_bytes(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTextAssetWrap__g_get_bytes_m819075780 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTextAssetWrap__g_get_bytes_m819075780_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- TextAsset_t3022178571 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((TextAsset_t3022178571 *)CastclassClass((RuntimeObject*)L_5, TextAsset_t3022178571_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- TextAsset_t3022178571 * L_7 = V_1;
- NullCheck(L_7);
- ByteU5BU5D_t4116647657* L_8 = TextAsset_get_bytes_m1826471440(L_7, /*hidden argument*/NULL);
- Lua_lua_pushstring_m3272202343(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap___CreateInstance_m626113703(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap___CreateInstance_m626113703(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_time_m1863490483(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_time_m1863490483(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_deltaTime_m201033604(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_deltaTime_m201033604(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_fixedTime_m1141309118(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_fixedTime_m1141309118(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_unscaledTime_m1722259242(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_unscaledTime_m1722259242(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_timeScale_m3205244298(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_timeScale_m3205244298(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_frameCount_m2155433661(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_frameCount_m2155433661(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_captureFramerate_m587593122(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_captureFramerate_m587593122(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__s_set_timeScale_m2124012409(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__s_set_timeScale_m2124012409(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTimeWrap__s_set_captureFramerate_m3614803111(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTimeWrap__s_set_captureFramerate_m3614803111(NULL, ___L0, NULL);
- return returnValue;
- }
- // System.Void XLua.CSObjectWrap.UnityEngineTimeWrap::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineTimeWrap__ctor_m3678023869 (UnityEngineTimeWrap_t504182158 * __this, const RuntimeMethod* method)
- {
- {
- Object__ctor_m297566312(__this, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Void XLua.CSObjectWrap.UnityEngineTimeWrap::__Register(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineTimeWrap___Register_m1297693217 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap___Register_m1297693217_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- intptr_t G_B2_0;
- memset(&G_B2_0, 0, sizeof(G_B2_0));
- Type_t * G_B2_1 = NULL;
- intptr_t G_B1_0;
- memset(&G_B1_0, 0, sizeof(G_B1_0));
- Type_t * G_B1_1 = NULL;
- String_t* G_B4_0 = NULL;
- int32_t G_B4_1 = 0;
- intptr_t G_B4_2;
- memset(&G_B4_2, 0, sizeof(G_B4_2));
- String_t* G_B3_0 = NULL;
- int32_t G_B3_1 = 0;
- intptr_t G_B3_2;
- memset(&G_B3_2, 0, sizeof(G_B3_2));
- String_t* G_B6_0 = NULL;
- int32_t G_B6_1 = 0;
- intptr_t G_B6_2;
- memset(&G_B6_2, 0, sizeof(G_B6_2));
- String_t* G_B5_0 = NULL;
- int32_t G_B5_1 = 0;
- intptr_t G_B5_2;
- memset(&G_B5_2, 0, sizeof(G_B5_2));
- String_t* G_B8_0 = NULL;
- int32_t G_B8_1 = 0;
- intptr_t G_B8_2;
- memset(&G_B8_2, 0, sizeof(G_B8_2));
- String_t* G_B7_0 = NULL;
- int32_t G_B7_1 = 0;
- intptr_t G_B7_2;
- memset(&G_B7_2, 0, sizeof(G_B7_2));
- String_t* G_B10_0 = NULL;
- int32_t G_B10_1 = 0;
- intptr_t G_B10_2;
- memset(&G_B10_2, 0, sizeof(G_B10_2));
- String_t* G_B9_0 = NULL;
- int32_t G_B9_1 = 0;
- intptr_t G_B9_2;
- memset(&G_B9_2, 0, sizeof(G_B9_2));
- String_t* G_B12_0 = NULL;
- int32_t G_B12_1 = 0;
- intptr_t G_B12_2;
- memset(&G_B12_2, 0, sizeof(G_B12_2));
- String_t* G_B11_0 = NULL;
- int32_t G_B11_1 = 0;
- intptr_t G_B11_2;
- memset(&G_B11_2, 0, sizeof(G_B11_2));
- String_t* G_B14_0 = NULL;
- int32_t G_B14_1 = 0;
- intptr_t G_B14_2;
- memset(&G_B14_2, 0, sizeof(G_B14_2));
- String_t* G_B13_0 = NULL;
- int32_t G_B13_1 = 0;
- intptr_t G_B13_2;
- memset(&G_B13_2, 0, sizeof(G_B13_2));
- String_t* G_B16_0 = NULL;
- int32_t G_B16_1 = 0;
- intptr_t G_B16_2;
- memset(&G_B16_2, 0, sizeof(G_B16_2));
- String_t* G_B15_0 = NULL;
- int32_t G_B15_1 = 0;
- intptr_t G_B15_2;
- memset(&G_B15_2, 0, sizeof(G_B15_2));
- String_t* G_B18_0 = NULL;
- int32_t G_B18_1 = 0;
- intptr_t G_B18_2;
- memset(&G_B18_2, 0, sizeof(G_B18_2));
- String_t* G_B17_0 = NULL;
- int32_t G_B17_1 = 0;
- intptr_t G_B17_2;
- memset(&G_B17_2, 0, sizeof(G_B17_2));
- String_t* G_B20_0 = NULL;
- int32_t G_B20_1 = 0;
- intptr_t G_B20_2;
- memset(&G_B20_2, 0, sizeof(G_B20_2));
- String_t* G_B19_0 = NULL;
- int32_t G_B19_1 = 0;
- intptr_t G_B19_2;
- memset(&G_B19_2, 0, sizeof(G_B19_2));
- String_t* G_B22_0 = NULL;
- int32_t G_B22_1 = 0;
- intptr_t G_B22_2;
- memset(&G_B22_2, 0, sizeof(G_B22_2));
- String_t* G_B21_0 = NULL;
- int32_t G_B21_1 = 0;
- intptr_t G_B21_2;
- memset(&G_B21_2, 0, sizeof(G_B21_2));
- String_t* G_B24_0 = NULL;
- int32_t G_B24_1 = 0;
- intptr_t G_B24_2;
- memset(&G_B24_2, 0, sizeof(G_B24_2));
- String_t* G_B23_0 = NULL;
- int32_t G_B23_1 = 0;
- intptr_t G_B23_2;
- memset(&G_B23_2, 0, sizeof(G_B23_2));
- String_t* G_B26_0 = NULL;
- int32_t G_B26_1 = 0;
- intptr_t G_B26_2;
- memset(&G_B26_2, 0, sizeof(G_B26_2));
- String_t* G_B25_0 = NULL;
- int32_t G_B25_1 = 0;
- intptr_t G_B25_2;
- memset(&G_B25_2, 0, sizeof(G_B25_2));
- String_t* G_B28_0 = NULL;
- int32_t G_B28_1 = 0;
- intptr_t G_B28_2;
- memset(&G_B28_2, 0, sizeof(G_B28_2));
- String_t* G_B27_0 = NULL;
- int32_t G_B27_1 = 0;
- intptr_t G_B27_2;
- memset(&G_B27_2, 0, sizeof(G_B27_2));
- String_t* G_B30_0 = NULL;
- int32_t G_B30_1 = 0;
- intptr_t G_B30_2;
- memset(&G_B30_2, 0, sizeof(G_B30_2));
- String_t* G_B29_0 = NULL;
- int32_t G_B29_1 = 0;
- intptr_t G_B29_2;
- memset(&G_B29_2, 0, sizeof(G_B29_2));
- String_t* G_B32_0 = NULL;
- int32_t G_B32_1 = 0;
- intptr_t G_B32_2;
- memset(&G_B32_2, 0, sizeof(G_B32_2));
- String_t* G_B31_0 = NULL;
- int32_t G_B31_1 = 0;
- intptr_t G_B31_2;
- memset(&G_B31_2, 0, sizeof(G_B31_2));
- String_t* G_B34_0 = NULL;
- int32_t G_B34_1 = 0;
- intptr_t G_B34_2;
- memset(&G_B34_2, 0, sizeof(G_B34_2));
- String_t* G_B33_0 = NULL;
- int32_t G_B33_1 = 0;
- intptr_t G_B33_2;
- memset(&G_B33_2, 0, sizeof(G_B33_2));
- String_t* G_B36_0 = NULL;
- int32_t G_B36_1 = 0;
- intptr_t G_B36_2;
- memset(&G_B36_2, 0, sizeof(G_B36_2));
- String_t* G_B35_0 = NULL;
- int32_t G_B35_1 = 0;
- intptr_t G_B35_2;
- memset(&G_B35_2, 0, sizeof(G_B35_2));
- String_t* G_B38_0 = NULL;
- int32_t G_B38_1 = 0;
- intptr_t G_B38_2;
- memset(&G_B38_2, 0, sizeof(G_B38_2));
- String_t* G_B37_0 = NULL;
- int32_t G_B37_1 = 0;
- intptr_t G_B37_2;
- memset(&G_B37_2, 0, sizeof(G_B37_2));
- String_t* G_B40_0 = NULL;
- int32_t G_B40_1 = 0;
- intptr_t G_B40_2;
- memset(&G_B40_2, 0, sizeof(G_B40_2));
- String_t* G_B39_0 = NULL;
- int32_t G_B39_1 = 0;
- intptr_t G_B39_2;
- memset(&G_B39_2, 0, sizeof(G_B39_2));
- String_t* G_B42_0 = NULL;
- int32_t G_B42_1 = 0;
- intptr_t G_B42_2;
- memset(&G_B42_2, 0, sizeof(G_B42_2));
- String_t* G_B41_0 = NULL;
- int32_t G_B41_1 = 0;
- intptr_t G_B41_2;
- memset(&G_B41_2, 0, sizeof(G_B41_2));
- String_t* G_B44_0 = NULL;
- int32_t G_B44_1 = 0;
- intptr_t G_B44_2;
- memset(&G_B44_2, 0, sizeof(G_B44_2));
- String_t* G_B43_0 = NULL;
- int32_t G_B43_1 = 0;
- intptr_t G_B43_2;
- memset(&G_B43_2, 0, sizeof(G_B43_2));
- String_t* G_B46_0 = NULL;
- int32_t G_B46_1 = 0;
- intptr_t G_B46_2;
- memset(&G_B46_2, 0, sizeof(G_B46_2));
- String_t* G_B45_0 = NULL;
- int32_t G_B45_1 = 0;
- intptr_t G_B45_2;
- memset(&G_B45_2, 0, sizeof(G_B45_2));
- String_t* G_B48_0 = NULL;
- int32_t G_B48_1 = 0;
- intptr_t G_B48_2;
- memset(&G_B48_2, 0, sizeof(G_B48_2));
- String_t* G_B47_0 = NULL;
- int32_t G_B47_1 = 0;
- intptr_t G_B47_2;
- memset(&G_B47_2, 0, sizeof(G_B47_2));
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- RuntimeTypeHandle_t3027515415 L_3 = { reinterpret_cast<intptr_t> (Time_t2420636075_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_4 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- Type_t * L_5 = V_1;
- intptr_t L_6 = ___L0;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- Utils_BeginObjectRegister_m972381667(NULL /*static, unused*/, L_5, L_6, L_7, 0, 0, 0, 0, (-1), /*hidden argument*/NULL);
- Type_t * L_8 = V_1;
- intptr_t L_9 = ___L0;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- Utils_EndObjectRegister_m3642684994(NULL /*static, unused*/, L_8, L_9, L_10, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, (Type_t *)NULL, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, /*hidden argument*/NULL);
- Type_t * L_11 = V_1;
- intptr_t L_12 = ___L0;
- lua_CSFunction_t883524059 * L_13 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- G_B1_0 = L_12;
- G_B1_1 = L_11;
- if (L_13)
- {
- G_B2_0 = L_12;
- G_B2_1 = L_11;
- goto IL_004b;
- }
- }
- {
- intptr_t L_14 = (intptr_t)UnityEngineTimeWrap___CreateInstance_m626113703_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_15 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_15, NULL, L_14, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache0_0(L_15);
- G_B2_0 = G_B1_0;
- G_B2_1 = G_B1_1;
- }
- IL_004b:
- {
- lua_CSFunction_t883524059 * L_16 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- Utils_BeginClassRegister_m3630094254(NULL /*static, unused*/, G_B2_1, G_B2_0, L_16, 1, ((int32_t)18), 5, /*hidden argument*/NULL);
- intptr_t L_17 = ___L0;
- lua_CSFunction_t883524059 * L_18 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- G_B3_0 = _stringLiteral63249541;
- G_B3_1 = ((int32_t)-2);
- G_B3_2 = L_17;
- if (L_18)
- {
- G_B4_0 = _stringLiteral63249541;
- G_B4_1 = ((int32_t)-2);
- G_B4_2 = L_17;
- goto IL_0079;
- }
- }
- {
- intptr_t L_19 = (intptr_t)UnityEngineTimeWrap__g_get_time_m1863490483_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_20 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_20, NULL, L_19, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1_1(L_20);
- G_B4_0 = G_B3_0;
- G_B4_1 = G_B3_1;
- G_B4_2 = G_B3_2;
- }
- IL_0079:
- {
- lua_CSFunction_t883524059 * L_21 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B4_2, G_B4_1, G_B4_0, L_21, /*hidden argument*/NULL);
- intptr_t L_22 = ___L0;
- lua_CSFunction_t883524059 * L_23 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- G_B5_0 = _stringLiteral3175980615;
- G_B5_1 = ((int32_t)-2);
- G_B5_2 = L_22;
- if (L_23)
- {
- G_B6_0 = _stringLiteral3175980615;
- G_B6_1 = ((int32_t)-2);
- G_B6_2 = L_22;
- goto IL_00a3;
- }
- }
- {
- intptr_t L_24 = (intptr_t)UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_25 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_25, NULL, L_24, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2_2(L_25);
- G_B6_0 = G_B5_0;
- G_B6_1 = G_B5_1;
- G_B6_2 = G_B5_2;
- }
- IL_00a3:
- {
- lua_CSFunction_t883524059 * L_26 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B6_2, G_B6_1, G_B6_0, L_26, /*hidden argument*/NULL);
- intptr_t L_27 = ___L0;
- lua_CSFunction_t883524059 * L_28 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- G_B7_0 = _stringLiteral1236680008;
- G_B7_1 = ((int32_t)-2);
- G_B7_2 = L_27;
- if (L_28)
- {
- G_B8_0 = _stringLiteral1236680008;
- G_B8_1 = ((int32_t)-2);
- G_B8_2 = L_27;
- goto IL_00cd;
- }
- }
- {
- intptr_t L_29 = (intptr_t)UnityEngineTimeWrap__g_get_deltaTime_m201033604_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_30 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_30, NULL, L_29, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3_3(L_30);
- G_B8_0 = G_B7_0;
- G_B8_1 = G_B7_1;
- G_B8_2 = G_B7_2;
- }
- IL_00cd:
- {
- lua_CSFunction_t883524059 * L_31 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B8_2, G_B8_1, G_B8_0, L_31, /*hidden argument*/NULL);
- intptr_t L_32 = ___L0;
- lua_CSFunction_t883524059 * L_33 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- G_B9_0 = _stringLiteral1266844689;
- G_B9_1 = ((int32_t)-2);
- G_B9_2 = L_32;
- if (L_33)
- {
- G_B10_0 = _stringLiteral1266844689;
- G_B10_1 = ((int32_t)-2);
- G_B10_2 = L_32;
- goto IL_00f7;
- }
- }
- {
- intptr_t L_34 = (intptr_t)UnityEngineTimeWrap__g_get_fixedTime_m1141309118_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_35 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_35, NULL, L_34, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4_4(L_35);
- G_B10_0 = G_B9_0;
- G_B10_1 = G_B9_1;
- G_B10_2 = G_B9_2;
- }
- IL_00f7:
- {
- lua_CSFunction_t883524059 * L_36 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B10_2, G_B10_1, G_B10_0, L_36, /*hidden argument*/NULL);
- intptr_t L_37 = ___L0;
- lua_CSFunction_t883524059 * L_38 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- G_B11_0 = _stringLiteral3813774167;
- G_B11_1 = ((int32_t)-2);
- G_B11_2 = L_37;
- if (L_38)
- {
- G_B12_0 = _stringLiteral3813774167;
- G_B12_1 = ((int32_t)-2);
- G_B12_2 = L_37;
- goto IL_0121;
- }
- }
- {
- intptr_t L_39 = (intptr_t)UnityEngineTimeWrap__g_get_unscaledTime_m1722259242_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_40 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_40, NULL, L_39, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache5_5(L_40);
- G_B12_0 = G_B11_0;
- G_B12_1 = G_B11_1;
- G_B12_2 = G_B11_2;
- }
- IL_0121:
- {
- lua_CSFunction_t883524059 * L_41 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B12_2, G_B12_1, G_B12_0, L_41, /*hidden argument*/NULL);
- intptr_t L_42 = ___L0;
- lua_CSFunction_t883524059 * L_43 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- G_B13_0 = _stringLiteral2671238855;
- G_B13_1 = ((int32_t)-2);
- G_B13_2 = L_42;
- if (L_43)
- {
- G_B14_0 = _stringLiteral2671238855;
- G_B14_1 = ((int32_t)-2);
- G_B14_2 = L_42;
- goto IL_014b;
- }
- }
- {
- intptr_t L_44 = (intptr_t)UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_45 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_45, NULL, L_44, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache6_6(L_45);
- G_B14_0 = G_B13_0;
- G_B14_1 = G_B13_1;
- G_B14_2 = G_B13_2;
- }
- IL_014b:
- {
- lua_CSFunction_t883524059 * L_46 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B14_2, G_B14_1, G_B14_0, L_46, /*hidden argument*/NULL);
- intptr_t L_47 = ___L0;
- lua_CSFunction_t883524059 * L_48 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- G_B15_0 = _stringLiteral4116380890;
- G_B15_1 = ((int32_t)-2);
- G_B15_2 = L_47;
- if (L_48)
- {
- G_B16_0 = _stringLiteral4116380890;
- G_B16_1 = ((int32_t)-2);
- G_B16_2 = L_47;
- goto IL_0175;
- }
- }
- {
- intptr_t L_49 = (intptr_t)UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_50 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_50, NULL, L_49, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache7_7(L_50);
- G_B16_0 = G_B15_0;
- G_B16_1 = G_B15_1;
- G_B16_2 = G_B15_2;
- }
- IL_0175:
- {
- lua_CSFunction_t883524059 * L_51 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B16_2, G_B16_1, G_B16_0, L_51, /*hidden argument*/NULL);
- intptr_t L_52 = ___L0;
- lua_CSFunction_t883524059 * L_53 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- G_B17_0 = _stringLiteral2267104746;
- G_B17_1 = ((int32_t)-2);
- G_B17_2 = L_52;
- if (L_53)
- {
- G_B18_0 = _stringLiteral2267104746;
- G_B18_1 = ((int32_t)-2);
- G_B18_2 = L_52;
- goto IL_019f;
- }
- }
- {
- intptr_t L_54 = (intptr_t)UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_55 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_55, NULL, L_54, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache8_8(L_55);
- G_B18_0 = G_B17_0;
- G_B18_1 = G_B17_1;
- G_B18_2 = G_B17_2;
- }
- IL_019f:
- {
- lua_CSFunction_t883524059 * L_56 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B18_2, G_B18_1, G_B18_0, L_56, /*hidden argument*/NULL);
- intptr_t L_57 = ___L0;
- lua_CSFunction_t883524059 * L_58 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- G_B19_0 = _stringLiteral1879621273;
- G_B19_1 = ((int32_t)-2);
- G_B19_2 = L_57;
- if (L_58)
- {
- G_B20_0 = _stringLiteral1879621273;
- G_B20_1 = ((int32_t)-2);
- G_B20_2 = L_57;
- goto IL_01c9;
- }
- }
- {
- intptr_t L_59 = (intptr_t)UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_60 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_60, NULL, L_59, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache9_9(L_60);
- G_B20_0 = G_B19_0;
- G_B20_1 = G_B19_1;
- G_B20_2 = G_B19_2;
- }
- IL_01c9:
- {
- lua_CSFunction_t883524059 * L_61 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B20_2, G_B20_1, G_B20_0, L_61, /*hidden argument*/NULL);
- intptr_t L_62 = ___L0;
- lua_CSFunction_t883524059 * L_63 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- G_B21_0 = _stringLiteral3125897083;
- G_B21_1 = ((int32_t)-2);
- G_B21_2 = L_62;
- if (L_63)
- {
- G_B22_0 = _stringLiteral3125897083;
- G_B22_1 = ((int32_t)-2);
- G_B22_2 = L_62;
- goto IL_01f3;
- }
- }
- {
- intptr_t L_64 = (intptr_t)UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_65 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_65, NULL, L_64, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheA_10(L_65);
- G_B22_0 = G_B21_0;
- G_B22_1 = G_B21_1;
- G_B22_2 = G_B21_2;
- }
- IL_01f3:
- {
- lua_CSFunction_t883524059 * L_66 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B22_2, G_B22_1, G_B22_0, L_66, /*hidden argument*/NULL);
- intptr_t L_67 = ___L0;
- lua_CSFunction_t883524059 * L_68 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- G_B23_0 = _stringLiteral851332882;
- G_B23_1 = ((int32_t)-2);
- G_B23_2 = L_67;
- if (L_68)
- {
- G_B24_0 = _stringLiteral851332882;
- G_B24_1 = ((int32_t)-2);
- G_B24_2 = L_67;
- goto IL_021d;
- }
- }
- {
- intptr_t L_69 = (intptr_t)UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_70 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_70, NULL, L_69, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheB_11(L_70);
- G_B24_0 = G_B23_0;
- G_B24_1 = G_B23_1;
- G_B24_2 = G_B23_2;
- }
- IL_021d:
- {
- lua_CSFunction_t883524059 * L_71 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B24_2, G_B24_1, G_B24_0, L_71, /*hidden argument*/NULL);
- intptr_t L_72 = ___L0;
- lua_CSFunction_t883524059 * L_73 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- G_B25_0 = _stringLiteral2979169347;
- G_B25_1 = ((int32_t)-2);
- G_B25_2 = L_72;
- if (L_73)
- {
- G_B26_0 = _stringLiteral2979169347;
- G_B26_1 = ((int32_t)-2);
- G_B26_2 = L_72;
- goto IL_0247;
- }
- }
- {
- intptr_t L_74 = (intptr_t)UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_75 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_75, NULL, L_74, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheC_12(L_75);
- G_B26_0 = G_B25_0;
- G_B26_1 = G_B25_1;
- G_B26_2 = G_B25_2;
- }
- IL_0247:
- {
- lua_CSFunction_t883524059 * L_76 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B26_2, G_B26_1, G_B26_0, L_76, /*hidden argument*/NULL);
- intptr_t L_77 = ___L0;
- lua_CSFunction_t883524059 * L_78 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- G_B27_0 = _stringLiteral1186667495;
- G_B27_1 = ((int32_t)-2);
- G_B27_2 = L_77;
- if (L_78)
- {
- G_B28_0 = _stringLiteral1186667495;
- G_B28_1 = ((int32_t)-2);
- G_B28_2 = L_77;
- goto IL_0271;
- }
- }
- {
- intptr_t L_79 = (intptr_t)UnityEngineTimeWrap__g_get_timeScale_m3205244298_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_80 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_80, NULL, L_79, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheD_13(L_80);
- G_B28_0 = G_B27_0;
- G_B28_1 = G_B27_1;
- G_B28_2 = G_B27_2;
- }
- IL_0271:
- {
- lua_CSFunction_t883524059 * L_81 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B28_2, G_B28_1, G_B28_0, L_81, /*hidden argument*/NULL);
- intptr_t L_82 = ___L0;
- lua_CSFunction_t883524059 * L_83 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- G_B29_0 = _stringLiteral207938285;
- G_B29_1 = ((int32_t)-2);
- G_B29_2 = L_82;
- if (L_83)
- {
- G_B30_0 = _stringLiteral207938285;
- G_B30_1 = ((int32_t)-2);
- G_B30_2 = L_82;
- goto IL_029b;
- }
- }
- {
- intptr_t L_84 = (intptr_t)UnityEngineTimeWrap__g_get_frameCount_m2155433661_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_85 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_85, NULL, L_84, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheE_14(L_85);
- G_B30_0 = G_B29_0;
- G_B30_1 = G_B29_1;
- G_B30_2 = G_B29_2;
- }
- IL_029b:
- {
- lua_CSFunction_t883524059 * L_86 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B30_2, G_B30_1, G_B30_0, L_86, /*hidden argument*/NULL);
- intptr_t L_87 = ___L0;
- lua_CSFunction_t883524059 * L_88 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- G_B31_0 = _stringLiteral2873276515;
- G_B31_1 = ((int32_t)-2);
- G_B31_2 = L_87;
- if (L_88)
- {
- G_B32_0 = _stringLiteral2873276515;
- G_B32_1 = ((int32_t)-2);
- G_B32_2 = L_87;
- goto IL_02c5;
- }
- }
- {
- intptr_t L_89 = (intptr_t)UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_90 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_90, NULL, L_89, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheF_15(L_90);
- G_B32_0 = G_B31_0;
- G_B32_1 = G_B31_1;
- G_B32_2 = G_B31_2;
- }
- IL_02c5:
- {
- lua_CSFunction_t883524059 * L_91 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B32_2, G_B32_1, G_B32_0, L_91, /*hidden argument*/NULL);
- intptr_t L_92 = ___L0;
- lua_CSFunction_t883524059 * L_93 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- G_B33_0 = _stringLiteral3848975043;
- G_B33_1 = ((int32_t)-2);
- G_B33_2 = L_92;
- if (L_93)
- {
- G_B34_0 = _stringLiteral3848975043;
- G_B34_1 = ((int32_t)-2);
- G_B34_2 = L_92;
- goto IL_02ef;
- }
- }
- {
- intptr_t L_94 = (intptr_t)UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_95 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_95, NULL, L_94, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache10_16(L_95);
- G_B34_0 = G_B33_0;
- G_B34_1 = G_B33_1;
- G_B34_2 = G_B33_2;
- }
- IL_02ef:
- {
- lua_CSFunction_t883524059 * L_96 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B34_2, G_B34_1, G_B34_0, L_96, /*hidden argument*/NULL);
- intptr_t L_97 = ___L0;
- lua_CSFunction_t883524059 * L_98 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- G_B35_0 = _stringLiteral2234321686;
- G_B35_1 = ((int32_t)-2);
- G_B35_2 = L_97;
- if (L_98)
- {
- G_B36_0 = _stringLiteral2234321686;
- G_B36_1 = ((int32_t)-2);
- G_B36_2 = L_97;
- goto IL_0319;
- }
- }
- {
- intptr_t L_99 = (intptr_t)UnityEngineTimeWrap__g_get_captureFramerate_m587593122_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_100 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_100, NULL, L_99, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache11_17(L_100);
- G_B36_0 = G_B35_0;
- G_B36_1 = G_B35_1;
- G_B36_2 = G_B35_2;
- }
- IL_0319:
- {
- lua_CSFunction_t883524059 * L_101 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B36_2, G_B36_1, G_B36_0, L_101, /*hidden argument*/NULL);
- intptr_t L_102 = ___L0;
- lua_CSFunction_t883524059 * L_103 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache12_18();
- G_B37_0 = _stringLiteral3514965321;
- G_B37_1 = ((int32_t)-2);
- G_B37_2 = L_102;
- if (L_103)
- {
- G_B38_0 = _stringLiteral3514965321;
- G_B38_1 = ((int32_t)-2);
- G_B38_2 = L_102;
- goto IL_0343;
- }
- }
- {
- intptr_t L_104 = (intptr_t)UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_105 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_105, NULL, L_104, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache12_18(L_105);
- G_B38_0 = G_B37_0;
- G_B38_1 = G_B37_1;
- G_B38_2 = G_B37_2;
- }
- IL_0343:
- {
- lua_CSFunction_t883524059 * L_106 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache12_18();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B38_2, G_B38_1, G_B38_0, L_106, /*hidden argument*/NULL);
- intptr_t L_107 = ___L0;
- lua_CSFunction_t883524059 * L_108 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache13_19();
- G_B39_0 = _stringLiteral1879621273;
- G_B39_1 = (-1);
- G_B39_2 = L_107;
- if (L_108)
- {
- G_B40_0 = _stringLiteral1879621273;
- G_B40_1 = (-1);
- G_B40_2 = L_107;
- goto IL_036c;
- }
- }
- {
- intptr_t L_109 = (intptr_t)UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_110 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_110, NULL, L_109, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache13_19(L_110);
- G_B40_0 = G_B39_0;
- G_B40_1 = G_B39_1;
- G_B40_2 = G_B39_2;
- }
- IL_036c:
- {
- lua_CSFunction_t883524059 * L_111 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache13_19();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B40_2, G_B40_1, G_B40_0, L_111, /*hidden argument*/NULL);
- intptr_t L_112 = ___L0;
- lua_CSFunction_t883524059 * L_113 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache14_20();
- G_B41_0 = _stringLiteral3125897083;
- G_B41_1 = (-1);
- G_B41_2 = L_112;
- if (L_113)
- {
- G_B42_0 = _stringLiteral3125897083;
- G_B42_1 = (-1);
- G_B42_2 = L_112;
- goto IL_0395;
- }
- }
- {
- intptr_t L_114 = (intptr_t)UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_115 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_115, NULL, L_114, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache14_20(L_115);
- G_B42_0 = G_B41_0;
- G_B42_1 = G_B41_1;
- G_B42_2 = G_B41_2;
- }
- IL_0395:
- {
- lua_CSFunction_t883524059 * L_116 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache14_20();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B42_2, G_B42_1, G_B42_0, L_116, /*hidden argument*/NULL);
- intptr_t L_117 = ___L0;
- lua_CSFunction_t883524059 * L_118 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache15_21();
- G_B43_0 = _stringLiteral2979169347;
- G_B43_1 = (-1);
- G_B43_2 = L_117;
- if (L_118)
- {
- G_B44_0 = _stringLiteral2979169347;
- G_B44_1 = (-1);
- G_B44_2 = L_117;
- goto IL_03be;
- }
- }
- {
- intptr_t L_119 = (intptr_t)UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_120 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_120, NULL, L_119, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache15_21(L_120);
- G_B44_0 = G_B43_0;
- G_B44_1 = G_B43_1;
- G_B44_2 = G_B43_2;
- }
- IL_03be:
- {
- lua_CSFunction_t883524059 * L_121 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache15_21();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B44_2, G_B44_1, G_B44_0, L_121, /*hidden argument*/NULL);
- intptr_t L_122 = ___L0;
- lua_CSFunction_t883524059 * L_123 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache16_22();
- G_B45_0 = _stringLiteral1186667495;
- G_B45_1 = (-1);
- G_B45_2 = L_122;
- if (L_123)
- {
- G_B46_0 = _stringLiteral1186667495;
- G_B46_1 = (-1);
- G_B46_2 = L_122;
- goto IL_03e7;
- }
- }
- {
- intptr_t L_124 = (intptr_t)UnityEngineTimeWrap__s_set_timeScale_m2124012409_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_125 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_125, NULL, L_124, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache16_22(L_125);
- G_B46_0 = G_B45_0;
- G_B46_1 = G_B45_1;
- G_B46_2 = G_B45_2;
- }
- IL_03e7:
- {
- lua_CSFunction_t883524059 * L_126 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache16_22();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B46_2, G_B46_1, G_B46_0, L_126, /*hidden argument*/NULL);
- intptr_t L_127 = ___L0;
- lua_CSFunction_t883524059 * L_128 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache17_23();
- G_B47_0 = _stringLiteral2234321686;
- G_B47_1 = (-1);
- G_B47_2 = L_127;
- if (L_128)
- {
- G_B48_0 = _stringLiteral2234321686;
- G_B48_1 = (-1);
- G_B48_2 = L_127;
- goto IL_0410;
- }
- }
- {
- intptr_t L_129 = (intptr_t)UnityEngineTimeWrap__s_set_captureFramerate_m3614803111_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_130 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_130, NULL, L_129, /*hidden argument*/NULL);
- ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache17_23(L_130);
- G_B48_0 = G_B47_0;
- G_B48_1 = G_B47_1;
- G_B48_2 = G_B47_2;
- }
- IL_0410:
- {
- lua_CSFunction_t883524059 * L_131 = ((UnityEngineTimeWrap_t504182158_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTimeWrap_t504182158_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache17_23();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B48_2, G_B48_1, G_B48_0, L_131, /*hidden argument*/NULL);
- Type_t * L_132 = V_1;
- intptr_t L_133 = ___L0;
- ObjectTranslator_t2020767555 * L_134 = V_0;
- Utils_EndClassRegister_m1460189367(NULL /*static, unused*/, L_132, L_133, L_134, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap___CreateInstance_m626113703 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap___CreateInstance_m626113703_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Time_t2420636075 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_4) == ((uint32_t)1))))
- {
- goto IL_002d;
- }
- }
- IL_0018:
- {
- Time_t2420636075 * L_5 = (Time_t2420636075 *)il2cpp_codegen_object_new(Time_t2420636075_il2cpp_TypeInfo_var);
- Time__ctor_m872844386(L_5, /*hidden argument*/NULL);
- V_1 = L_5;
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Time_t2420636075 * L_8 = V_1;
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_8, /*hidden argument*/NULL);
- V_2 = 1;
- goto IL_0056;
- }
- IL_002d:
- {
- goto IL_004a;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0032;
- throw e;
- }
- CATCH_0032:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_2 = L_12;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_004a:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, _stringLiteral3376816847, /*hidden argument*/NULL);
- return L_14;
- }
- IL_0056:
- {
- int32_t L_15 = V_2;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_time(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_time_m1863490483 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_time_m1863490483_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_time_m2907476221(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_timeSinceLevelLoad(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_timeSinceLevelLoad_m1044766555_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_timeSinceLevelLoad_m2224611026(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_deltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_deltaTime_m201033604 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_deltaTime_m201033604_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_deltaTime_m372706562(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedTime_m1141309118 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_fixedTime_m1141309118_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_fixedTime_m908791845(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_unscaledTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_unscaledTime_m1722259242 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_unscaledTime_m1722259242_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_unscaledTime_m3457564332(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedUnscaledTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_fixedUnscaledTime_m3264409301_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_fixedUnscaledTime_m2438369752(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_unscaledDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_unscaledDeltaTime_m705978923_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_unscaledDeltaTime_m4270080131(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedUnscaledDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_fixedUnscaledDeltaTime_m821775804_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_fixedUnscaledDeltaTime_m3271579190(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_fixedDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_fixedDeltaTime_m2209903229_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_fixedDeltaTime_m3595802076(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_maximumDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_maximumDeltaTime_m3282170166_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_maximumDeltaTime_m557735545(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_smoothDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_smoothDeltaTime_m242912761_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_smoothDeltaTime_m2285259559(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_maximumParticleDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_maximumParticleDeltaTime_m2624570947_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_maximumParticleDeltaTime_m3370030886(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_timeScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_timeScale_m3205244298 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_timeScale_m3205244298_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_timeScale_m701790074(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_frameCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_frameCount_m2155433661 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_frameCount_m2155433661_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- int32_t L_1 = Time_get_frameCount_m1220035214(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_0, L_1, /*hidden argument*/NULL);
- goto IL_0028;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0010;
- throw e;
- }
- CATCH_0010:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002a;
- } // end catch (depth: 1)
- IL_0028:
- {
- return 1;
- }
- IL_002a:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_renderedFrameCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_renderedFrameCount_m2616540006_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- int32_t L_1 = Time_get_renderedFrameCount_m3445787045(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_0, L_1, /*hidden argument*/NULL);
- goto IL_0028;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0010;
- throw e;
- }
- CATCH_0010:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002a;
- } // end catch (depth: 1)
- IL_0028:
- {
- return 1;
- }
- IL_002a:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_realtimeSinceStartup(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_realtimeSinceStartup_m2648321541_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- float L_1 = Time_get_realtimeSinceStartup_m3141794964(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_0, (((double)((double)L_1))), /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 1;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_captureFramerate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_captureFramerate_m587593122 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_captureFramerate_m587593122_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- int32_t L_1 = Time_get_captureFramerate_m4129865328(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_0, L_1, /*hidden argument*/NULL);
- goto IL_0028;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0010;
- throw e;
- }
- CATCH_0010:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002a;
- } // end catch (depth: 1)
- IL_0028:
- {
- return 1;
- }
- IL_002a:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_g_get_inFixedTimeStep(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__g_get_inFixedTimeStep_m1983435519_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- bool L_1 = Time_get_inFixedTimeStep_m4031040766(NULL /*static, unused*/, /*hidden argument*/NULL);
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_0, L_1, /*hidden argument*/NULL);
- goto IL_0028;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0010;
- throw e;
- }
- CATCH_0010:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002a;
- } // end catch (depth: 1)
- IL_0028:
- {
- return 1;
- }
- IL_002a:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_fixedDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__s_set_fixedDeltaTime_m1056492988_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- double L_1 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_0, 1, /*hidden argument*/NULL);
- Time_set_fixedDeltaTime_m2452744972(NULL /*static, unused*/, (((float)((float)L_1))), /*hidden argument*/NULL);
- goto IL_002a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0012;
- throw e;
- }
- CATCH_0012:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002c;
- } // end catch (depth: 1)
- IL_002a:
- {
- return 0;
- }
- IL_002c:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_maximumDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__s_set_maximumDeltaTime_m4229658109_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- double L_1 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_0, 1, /*hidden argument*/NULL);
- Time_set_maximumDeltaTime_m2052127828(NULL /*static, unused*/, (((float)((float)L_1))), /*hidden argument*/NULL);
- goto IL_002a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0012;
- throw e;
- }
- CATCH_0012:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002c;
- } // end catch (depth: 1)
- IL_002a:
- {
- return 0;
- }
- IL_002c:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_maximumParticleDeltaTime(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__s_set_maximumParticleDeltaTime_m4283277267_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- double L_1 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_0, 1, /*hidden argument*/NULL);
- Time_set_maximumParticleDeltaTime_m2614608890(NULL /*static, unused*/, (((float)((float)L_1))), /*hidden argument*/NULL);
- goto IL_002a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0012;
- throw e;
- }
- CATCH_0012:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002c;
- } // end catch (depth: 1)
- IL_002a:
- {
- return 0;
- }
- IL_002c:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_timeScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_timeScale_m2124012409 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__s_set_timeScale_m2124012409_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- double L_1 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_0, 1, /*hidden argument*/NULL);
- Time_set_timeScale_m1127545364(NULL /*static, unused*/, (((float)((float)L_1))), /*hidden argument*/NULL);
- goto IL_002a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0012;
- throw e;
- }
- CATCH_0012:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002c;
- } // end catch (depth: 1)
- IL_002a:
- {
- return 0;
- }
- IL_002c:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTimeWrap::_s_set_captureFramerate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTimeWrap__s_set_captureFramerate_m3614803111 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTimeWrap__s_set_captureFramerate_m3614803111_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- Exception_t * V_0 = NULL;
- int32_t V_1 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- intptr_t L_0 = ___L0;
- int32_t L_1 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_0, 1, /*hidden argument*/NULL);
- Time_set_captureFramerate_m161064716(NULL /*static, unused*/, L_1, /*hidden argument*/NULL);
- goto IL_0029;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0011;
- throw e;
- }
- CATCH_0011:
- { // begin catch(System.Exception)
- V_0 = ((Exception_t *)__exception_local);
- intptr_t L_2 = ___L0;
- Exception_t * L_3 = V_0;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_4 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_3, /*hidden argument*/NULL);
- int32_t L_5 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_2, L_4, /*hidden argument*/NULL);
- V_1 = L_5;
- goto IL_002b;
- } // end catch (depth: 1)
- IL_0029:
- {
- return 0;
- }
- IL_002b:
- {
- int32_t L_6 = V_1;
- return L_6;
- }
- }
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap___CreateInstance_m1894308163(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap___CreateInstance_m1894308163(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_SetParent_m804936730(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_SetParent_m804936730(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_Translate_m975680681(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_Translate_m975680681(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_Rotate_m1066480346(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_Rotate_m1066480346(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_RotateAround_m3000108533(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_RotateAround_m3000108533(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_LookAt_m1878060840(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_LookAt_m1878060840(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_TransformDirection_m4138306096(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_TransformDirection_m4138306096(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_TransformVector_m1514244944(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_TransformVector_m1514244944(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_InverseTransformVector_m1349495655(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_InverseTransformVector_m1349495655(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_TransformPoint_m1078881144(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_TransformPoint_m1078881144(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_InverseTransformPoint_m957968118(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_InverseTransformPoint_m957968118(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DetachChildren_m520041245(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DetachChildren_m520041245(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_Find_m1578719640(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_Find_m1578719640(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_IsChildOf_m764668816(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_IsChildOf_m764668816(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_GetEnumerator_m2850786488(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_GetEnumerator_m2850786488(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_GetChild_m1976232125(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_GetChild_m1976232125(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOMove_m2510464153(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOMove_m2510464153(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOMoveX_m427706497(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOMoveX_m427706497(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOMoveY_m3829814726(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOMoveY_m3829814726(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOMoveZ_m3431864067(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOMoveZ_m3431864067(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalMove_m602687662(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalMove_m602687662(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DORotate_m825617719(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DORotate_m825617719(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalRotate_m4095437176(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalRotate_m4095437176(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOScale_m1896281278(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOScale_m1896281278(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOScaleX_m2063790813(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOScaleX_m2063790813(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOScaleY_m3874994172(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOScaleY_m3874994172(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOScaleZ_m976566461(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOScaleZ_m976566461(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLookAt_m89020156(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLookAt_m89020156(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOPunchPosition_m1266900073(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOPunchPosition_m1266900073(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOPunchScale_m2535020043(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOPunchScale_m2535020043(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOPunchRotation_m3158922004(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOPunchRotation_m3158922004(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOShakePosition_m3720856662(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOShakePosition_m3720856662(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOShakeRotation_m241003690(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOShakeRotation_m241003690(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOShakeScale_m2406116869(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOShakeScale_m2406116869(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOJump_m4133327798(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOJump_m4133327798(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalJump_m296616187(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalJump_m296616187(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOPath_m2509685622(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOPath_m2509685622(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOLocalPath_m442715724(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOLocalPath_m442715724(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_position_m2180048924(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_position_m2180048924(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_localPosition_m3878105019(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_localPosition_m3878105019(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_eulerAngles_m3922999519(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_eulerAngles_m3922999519(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_right_m469775628(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_right_m469775628(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_up_m3208095539(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_up_m3208095539(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_forward_m2765842083(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_forward_m2765842083(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_rotation_m1745653753(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_rotation_m1745653753(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_localRotation_m637984894(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_localRotation_m637984894(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_localScale_m3915212871(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_localScale_m3915212871(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_parent_m3003513812(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_parent_m3003513812(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_root_m58896500(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_root_m58896500(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_childCount_m222537369(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_childCount_m222537369(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_lossyScale_m3129807950(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_lossyScale_m3129807950(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_hasChanged_m2133940418(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_hasChanged_m2133940418(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_position_m2248180735(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_position_m2248180735(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_localPosition_m572438127(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_localPosition_m572438127(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_eulerAngles_m2405101980(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_eulerAngles_m2405101980(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_right_m1502050898(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_right_m1502050898(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_up_m1616193993(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_up_m1616193993(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_forward_m1425629139(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_forward_m1425629139(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_rotation_m2344385924(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_rotation_m2344385924(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_localRotation_m3029152408(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_localRotation_m3029152408(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_localScale_m1212933853(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_localScale_m1212933853(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_parent_m3451686420(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_parent_m3451686420(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_hasChanged_m195551608(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_hasChanged_m195551608(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174(NULL, ___L0, NULL);
- return returnValue;
- }
- // System.Void XLua.CSObjectWrap.UnityEngineTransformWrap::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineTransformWrap__ctor_m3655446902 (UnityEngineTransformWrap_t3488644103 * __this, const RuntimeMethod* method)
- {
- {
- Object__ctor_m297566312(__this, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Void XLua.CSObjectWrap.UnityEngineTransformWrap::__Register(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineTransformWrap___Register_m4209511146 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap___Register_m4209511146_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- String_t* G_B2_0 = NULL;
- int32_t G_B2_1 = 0;
- intptr_t G_B2_2;
- memset(&G_B2_2, 0, sizeof(G_B2_2));
- String_t* G_B1_0 = NULL;
- int32_t G_B1_1 = 0;
- intptr_t G_B1_2;
- memset(&G_B1_2, 0, sizeof(G_B1_2));
- String_t* G_B4_0 = NULL;
- int32_t G_B4_1 = 0;
- intptr_t G_B4_2;
- memset(&G_B4_2, 0, sizeof(G_B4_2));
- String_t* G_B3_0 = NULL;
- int32_t G_B3_1 = 0;
- intptr_t G_B3_2;
- memset(&G_B3_2, 0, sizeof(G_B3_2));
- String_t* G_B6_0 = NULL;
- int32_t G_B6_1 = 0;
- intptr_t G_B6_2;
- memset(&G_B6_2, 0, sizeof(G_B6_2));
- String_t* G_B5_0 = NULL;
- int32_t G_B5_1 = 0;
- intptr_t G_B5_2;
- memset(&G_B5_2, 0, sizeof(G_B5_2));
- String_t* G_B8_0 = NULL;
- int32_t G_B8_1 = 0;
- intptr_t G_B8_2;
- memset(&G_B8_2, 0, sizeof(G_B8_2));
- String_t* G_B7_0 = NULL;
- int32_t G_B7_1 = 0;
- intptr_t G_B7_2;
- memset(&G_B7_2, 0, sizeof(G_B7_2));
- String_t* G_B10_0 = NULL;
- int32_t G_B10_1 = 0;
- intptr_t G_B10_2;
- memset(&G_B10_2, 0, sizeof(G_B10_2));
- String_t* G_B9_0 = NULL;
- int32_t G_B9_1 = 0;
- intptr_t G_B9_2;
- memset(&G_B9_2, 0, sizeof(G_B9_2));
- String_t* G_B12_0 = NULL;
- int32_t G_B12_1 = 0;
- intptr_t G_B12_2;
- memset(&G_B12_2, 0, sizeof(G_B12_2));
- String_t* G_B11_0 = NULL;
- int32_t G_B11_1 = 0;
- intptr_t G_B11_2;
- memset(&G_B11_2, 0, sizeof(G_B11_2));
- String_t* G_B14_0 = NULL;
- int32_t G_B14_1 = 0;
- intptr_t G_B14_2;
- memset(&G_B14_2, 0, sizeof(G_B14_2));
- String_t* G_B13_0 = NULL;
- int32_t G_B13_1 = 0;
- intptr_t G_B13_2;
- memset(&G_B13_2, 0, sizeof(G_B13_2));
- String_t* G_B16_0 = NULL;
- int32_t G_B16_1 = 0;
- intptr_t G_B16_2;
- memset(&G_B16_2, 0, sizeof(G_B16_2));
- String_t* G_B15_0 = NULL;
- int32_t G_B15_1 = 0;
- intptr_t G_B15_2;
- memset(&G_B15_2, 0, sizeof(G_B15_2));
- String_t* G_B18_0 = NULL;
- int32_t G_B18_1 = 0;
- intptr_t G_B18_2;
- memset(&G_B18_2, 0, sizeof(G_B18_2));
- String_t* G_B17_0 = NULL;
- int32_t G_B17_1 = 0;
- intptr_t G_B17_2;
- memset(&G_B17_2, 0, sizeof(G_B17_2));
- String_t* G_B20_0 = NULL;
- int32_t G_B20_1 = 0;
- intptr_t G_B20_2;
- memset(&G_B20_2, 0, sizeof(G_B20_2));
- String_t* G_B19_0 = NULL;
- int32_t G_B19_1 = 0;
- intptr_t G_B19_2;
- memset(&G_B19_2, 0, sizeof(G_B19_2));
- String_t* G_B22_0 = NULL;
- int32_t G_B22_1 = 0;
- intptr_t G_B22_2;
- memset(&G_B22_2, 0, sizeof(G_B22_2));
- String_t* G_B21_0 = NULL;
- int32_t G_B21_1 = 0;
- intptr_t G_B21_2;
- memset(&G_B21_2, 0, sizeof(G_B21_2));
- String_t* G_B24_0 = NULL;
- int32_t G_B24_1 = 0;
- intptr_t G_B24_2;
- memset(&G_B24_2, 0, sizeof(G_B24_2));
- String_t* G_B23_0 = NULL;
- int32_t G_B23_1 = 0;
- intptr_t G_B23_2;
- memset(&G_B23_2, 0, sizeof(G_B23_2));
- String_t* G_B26_0 = NULL;
- int32_t G_B26_1 = 0;
- intptr_t G_B26_2;
- memset(&G_B26_2, 0, sizeof(G_B26_2));
- String_t* G_B25_0 = NULL;
- int32_t G_B25_1 = 0;
- intptr_t G_B25_2;
- memset(&G_B25_2, 0, sizeof(G_B25_2));
- String_t* G_B28_0 = NULL;
- int32_t G_B28_1 = 0;
- intptr_t G_B28_2;
- memset(&G_B28_2, 0, sizeof(G_B28_2));
- String_t* G_B27_0 = NULL;
- int32_t G_B27_1 = 0;
- intptr_t G_B27_2;
- memset(&G_B27_2, 0, sizeof(G_B27_2));
- String_t* G_B30_0 = NULL;
- int32_t G_B30_1 = 0;
- intptr_t G_B30_2;
- memset(&G_B30_2, 0, sizeof(G_B30_2));
- String_t* G_B29_0 = NULL;
- int32_t G_B29_1 = 0;
- intptr_t G_B29_2;
- memset(&G_B29_2, 0, sizeof(G_B29_2));
- String_t* G_B32_0 = NULL;
- int32_t G_B32_1 = 0;
- intptr_t G_B32_2;
- memset(&G_B32_2, 0, sizeof(G_B32_2));
- String_t* G_B31_0 = NULL;
- int32_t G_B31_1 = 0;
- intptr_t G_B31_2;
- memset(&G_B31_2, 0, sizeof(G_B31_2));
- String_t* G_B34_0 = NULL;
- int32_t G_B34_1 = 0;
- intptr_t G_B34_2;
- memset(&G_B34_2, 0, sizeof(G_B34_2));
- String_t* G_B33_0 = NULL;
- int32_t G_B33_1 = 0;
- intptr_t G_B33_2;
- memset(&G_B33_2, 0, sizeof(G_B33_2));
- String_t* G_B36_0 = NULL;
- int32_t G_B36_1 = 0;
- intptr_t G_B36_2;
- memset(&G_B36_2, 0, sizeof(G_B36_2));
- String_t* G_B35_0 = NULL;
- int32_t G_B35_1 = 0;
- intptr_t G_B35_2;
- memset(&G_B35_2, 0, sizeof(G_B35_2));
- String_t* G_B38_0 = NULL;
- int32_t G_B38_1 = 0;
- intptr_t G_B38_2;
- memset(&G_B38_2, 0, sizeof(G_B38_2));
- String_t* G_B37_0 = NULL;
- int32_t G_B37_1 = 0;
- intptr_t G_B37_2;
- memset(&G_B37_2, 0, sizeof(G_B37_2));
- String_t* G_B40_0 = NULL;
- int32_t G_B40_1 = 0;
- intptr_t G_B40_2;
- memset(&G_B40_2, 0, sizeof(G_B40_2));
- String_t* G_B39_0 = NULL;
- int32_t G_B39_1 = 0;
- intptr_t G_B39_2;
- memset(&G_B39_2, 0, sizeof(G_B39_2));
- String_t* G_B42_0 = NULL;
- int32_t G_B42_1 = 0;
- intptr_t G_B42_2;
- memset(&G_B42_2, 0, sizeof(G_B42_2));
- String_t* G_B41_0 = NULL;
- int32_t G_B41_1 = 0;
- intptr_t G_B41_2;
- memset(&G_B41_2, 0, sizeof(G_B41_2));
- String_t* G_B44_0 = NULL;
- int32_t G_B44_1 = 0;
- intptr_t G_B44_2;
- memset(&G_B44_2, 0, sizeof(G_B44_2));
- String_t* G_B43_0 = NULL;
- int32_t G_B43_1 = 0;
- intptr_t G_B43_2;
- memset(&G_B43_2, 0, sizeof(G_B43_2));
- String_t* G_B46_0 = NULL;
- int32_t G_B46_1 = 0;
- intptr_t G_B46_2;
- memset(&G_B46_2, 0, sizeof(G_B46_2));
- String_t* G_B45_0 = NULL;
- int32_t G_B45_1 = 0;
- intptr_t G_B45_2;
- memset(&G_B45_2, 0, sizeof(G_B45_2));
- String_t* G_B48_0 = NULL;
- int32_t G_B48_1 = 0;
- intptr_t G_B48_2;
- memset(&G_B48_2, 0, sizeof(G_B48_2));
- String_t* G_B47_0 = NULL;
- int32_t G_B47_1 = 0;
- intptr_t G_B47_2;
- memset(&G_B47_2, 0, sizeof(G_B47_2));
- String_t* G_B50_0 = NULL;
- int32_t G_B50_1 = 0;
- intptr_t G_B50_2;
- memset(&G_B50_2, 0, sizeof(G_B50_2));
- String_t* G_B49_0 = NULL;
- int32_t G_B49_1 = 0;
- intptr_t G_B49_2;
- memset(&G_B49_2, 0, sizeof(G_B49_2));
- String_t* G_B52_0 = NULL;
- int32_t G_B52_1 = 0;
- intptr_t G_B52_2;
- memset(&G_B52_2, 0, sizeof(G_B52_2));
- String_t* G_B51_0 = NULL;
- int32_t G_B51_1 = 0;
- intptr_t G_B51_2;
- memset(&G_B51_2, 0, sizeof(G_B51_2));
- String_t* G_B54_0 = NULL;
- int32_t G_B54_1 = 0;
- intptr_t G_B54_2;
- memset(&G_B54_2, 0, sizeof(G_B54_2));
- String_t* G_B53_0 = NULL;
- int32_t G_B53_1 = 0;
- intptr_t G_B53_2;
- memset(&G_B53_2, 0, sizeof(G_B53_2));
- String_t* G_B56_0 = NULL;
- int32_t G_B56_1 = 0;
- intptr_t G_B56_2;
- memset(&G_B56_2, 0, sizeof(G_B56_2));
- String_t* G_B55_0 = NULL;
- int32_t G_B55_1 = 0;
- intptr_t G_B55_2;
- memset(&G_B55_2, 0, sizeof(G_B55_2));
- String_t* G_B58_0 = NULL;
- int32_t G_B58_1 = 0;
- intptr_t G_B58_2;
- memset(&G_B58_2, 0, sizeof(G_B58_2));
- String_t* G_B57_0 = NULL;
- int32_t G_B57_1 = 0;
- intptr_t G_B57_2;
- memset(&G_B57_2, 0, sizeof(G_B57_2));
- String_t* G_B60_0 = NULL;
- int32_t G_B60_1 = 0;
- intptr_t G_B60_2;
- memset(&G_B60_2, 0, sizeof(G_B60_2));
- String_t* G_B59_0 = NULL;
- int32_t G_B59_1 = 0;
- intptr_t G_B59_2;
- memset(&G_B59_2, 0, sizeof(G_B59_2));
- String_t* G_B62_0 = NULL;
- int32_t G_B62_1 = 0;
- intptr_t G_B62_2;
- memset(&G_B62_2, 0, sizeof(G_B62_2));
- String_t* G_B61_0 = NULL;
- int32_t G_B61_1 = 0;
- intptr_t G_B61_2;
- memset(&G_B61_2, 0, sizeof(G_B61_2));
- String_t* G_B64_0 = NULL;
- int32_t G_B64_1 = 0;
- intptr_t G_B64_2;
- memset(&G_B64_2, 0, sizeof(G_B64_2));
- String_t* G_B63_0 = NULL;
- int32_t G_B63_1 = 0;
- intptr_t G_B63_2;
- memset(&G_B63_2, 0, sizeof(G_B63_2));
- String_t* G_B66_0 = NULL;
- int32_t G_B66_1 = 0;
- intptr_t G_B66_2;
- memset(&G_B66_2, 0, sizeof(G_B66_2));
- String_t* G_B65_0 = NULL;
- int32_t G_B65_1 = 0;
- intptr_t G_B65_2;
- memset(&G_B65_2, 0, sizeof(G_B65_2));
- String_t* G_B68_0 = NULL;
- int32_t G_B68_1 = 0;
- intptr_t G_B68_2;
- memset(&G_B68_2, 0, sizeof(G_B68_2));
- String_t* G_B67_0 = NULL;
- int32_t G_B67_1 = 0;
- intptr_t G_B67_2;
- memset(&G_B67_2, 0, sizeof(G_B67_2));
- String_t* G_B70_0 = NULL;
- int32_t G_B70_1 = 0;
- intptr_t G_B70_2;
- memset(&G_B70_2, 0, sizeof(G_B70_2));
- String_t* G_B69_0 = NULL;
- int32_t G_B69_1 = 0;
- intptr_t G_B69_2;
- memset(&G_B69_2, 0, sizeof(G_B69_2));
- String_t* G_B72_0 = NULL;
- int32_t G_B72_1 = 0;
- intptr_t G_B72_2;
- memset(&G_B72_2, 0, sizeof(G_B72_2));
- String_t* G_B71_0 = NULL;
- int32_t G_B71_1 = 0;
- intptr_t G_B71_2;
- memset(&G_B71_2, 0, sizeof(G_B71_2));
- String_t* G_B74_0 = NULL;
- int32_t G_B74_1 = 0;
- intptr_t G_B74_2;
- memset(&G_B74_2, 0, sizeof(G_B74_2));
- String_t* G_B73_0 = NULL;
- int32_t G_B73_1 = 0;
- intptr_t G_B73_2;
- memset(&G_B73_2, 0, sizeof(G_B73_2));
- String_t* G_B76_0 = NULL;
- int32_t G_B76_1 = 0;
- intptr_t G_B76_2;
- memset(&G_B76_2, 0, sizeof(G_B76_2));
- String_t* G_B75_0 = NULL;
- int32_t G_B75_1 = 0;
- intptr_t G_B75_2;
- memset(&G_B75_2, 0, sizeof(G_B75_2));
- String_t* G_B78_0 = NULL;
- int32_t G_B78_1 = 0;
- intptr_t G_B78_2;
- memset(&G_B78_2, 0, sizeof(G_B78_2));
- String_t* G_B77_0 = NULL;
- int32_t G_B77_1 = 0;
- intptr_t G_B77_2;
- memset(&G_B77_2, 0, sizeof(G_B77_2));
- String_t* G_B80_0 = NULL;
- int32_t G_B80_1 = 0;
- intptr_t G_B80_2;
- memset(&G_B80_2, 0, sizeof(G_B80_2));
- String_t* G_B79_0 = NULL;
- int32_t G_B79_1 = 0;
- intptr_t G_B79_2;
- memset(&G_B79_2, 0, sizeof(G_B79_2));
- String_t* G_B82_0 = NULL;
- int32_t G_B82_1 = 0;
- intptr_t G_B82_2;
- memset(&G_B82_2, 0, sizeof(G_B82_2));
- String_t* G_B81_0 = NULL;
- int32_t G_B81_1 = 0;
- intptr_t G_B81_2;
- memset(&G_B81_2, 0, sizeof(G_B81_2));
- String_t* G_B84_0 = NULL;
- int32_t G_B84_1 = 0;
- intptr_t G_B84_2;
- memset(&G_B84_2, 0, sizeof(G_B84_2));
- String_t* G_B83_0 = NULL;
- int32_t G_B83_1 = 0;
- intptr_t G_B83_2;
- memset(&G_B83_2, 0, sizeof(G_B83_2));
- String_t* G_B86_0 = NULL;
- int32_t G_B86_1 = 0;
- intptr_t G_B86_2;
- memset(&G_B86_2, 0, sizeof(G_B86_2));
- String_t* G_B85_0 = NULL;
- int32_t G_B85_1 = 0;
- intptr_t G_B85_2;
- memset(&G_B85_2, 0, sizeof(G_B85_2));
- String_t* G_B88_0 = NULL;
- int32_t G_B88_1 = 0;
- intptr_t G_B88_2;
- memset(&G_B88_2, 0, sizeof(G_B88_2));
- String_t* G_B87_0 = NULL;
- int32_t G_B87_1 = 0;
- intptr_t G_B87_2;
- memset(&G_B87_2, 0, sizeof(G_B87_2));
- String_t* G_B90_0 = NULL;
- int32_t G_B90_1 = 0;
- intptr_t G_B90_2;
- memset(&G_B90_2, 0, sizeof(G_B90_2));
- String_t* G_B89_0 = NULL;
- int32_t G_B89_1 = 0;
- intptr_t G_B89_2;
- memset(&G_B89_2, 0, sizeof(G_B89_2));
- String_t* G_B92_0 = NULL;
- int32_t G_B92_1 = 0;
- intptr_t G_B92_2;
- memset(&G_B92_2, 0, sizeof(G_B92_2));
- String_t* G_B91_0 = NULL;
- int32_t G_B91_1 = 0;
- intptr_t G_B91_2;
- memset(&G_B91_2, 0, sizeof(G_B91_2));
- String_t* G_B94_0 = NULL;
- int32_t G_B94_1 = 0;
- intptr_t G_B94_2;
- memset(&G_B94_2, 0, sizeof(G_B94_2));
- String_t* G_B93_0 = NULL;
- int32_t G_B93_1 = 0;
- intptr_t G_B93_2;
- memset(&G_B93_2, 0, sizeof(G_B93_2));
- String_t* G_B96_0 = NULL;
- int32_t G_B96_1 = 0;
- intptr_t G_B96_2;
- memset(&G_B96_2, 0, sizeof(G_B96_2));
- String_t* G_B95_0 = NULL;
- int32_t G_B95_1 = 0;
- intptr_t G_B95_2;
- memset(&G_B95_2, 0, sizeof(G_B95_2));
- String_t* G_B98_0 = NULL;
- int32_t G_B98_1 = 0;
- intptr_t G_B98_2;
- memset(&G_B98_2, 0, sizeof(G_B98_2));
- String_t* G_B97_0 = NULL;
- int32_t G_B97_1 = 0;
- intptr_t G_B97_2;
- memset(&G_B97_2, 0, sizeof(G_B97_2));
- String_t* G_B100_0 = NULL;
- int32_t G_B100_1 = 0;
- intptr_t G_B100_2;
- memset(&G_B100_2, 0, sizeof(G_B100_2));
- String_t* G_B99_0 = NULL;
- int32_t G_B99_1 = 0;
- intptr_t G_B99_2;
- memset(&G_B99_2, 0, sizeof(G_B99_2));
- String_t* G_B102_0 = NULL;
- int32_t G_B102_1 = 0;
- intptr_t G_B102_2;
- memset(&G_B102_2, 0, sizeof(G_B102_2));
- String_t* G_B101_0 = NULL;
- int32_t G_B101_1 = 0;
- intptr_t G_B101_2;
- memset(&G_B101_2, 0, sizeof(G_B101_2));
- String_t* G_B104_0 = NULL;
- int32_t G_B104_1 = 0;
- intptr_t G_B104_2;
- memset(&G_B104_2, 0, sizeof(G_B104_2));
- String_t* G_B103_0 = NULL;
- int32_t G_B103_1 = 0;
- intptr_t G_B103_2;
- memset(&G_B103_2, 0, sizeof(G_B103_2));
- String_t* G_B106_0 = NULL;
- int32_t G_B106_1 = 0;
- intptr_t G_B106_2;
- memset(&G_B106_2, 0, sizeof(G_B106_2));
- String_t* G_B105_0 = NULL;
- int32_t G_B105_1 = 0;
- intptr_t G_B105_2;
- memset(&G_B105_2, 0, sizeof(G_B105_2));
- String_t* G_B108_0 = NULL;
- int32_t G_B108_1 = 0;
- intptr_t G_B108_2;
- memset(&G_B108_2, 0, sizeof(G_B108_2));
- String_t* G_B107_0 = NULL;
- int32_t G_B107_1 = 0;
- intptr_t G_B107_2;
- memset(&G_B107_2, 0, sizeof(G_B107_2));
- String_t* G_B110_0 = NULL;
- int32_t G_B110_1 = 0;
- intptr_t G_B110_2;
- memset(&G_B110_2, 0, sizeof(G_B110_2));
- String_t* G_B109_0 = NULL;
- int32_t G_B109_1 = 0;
- intptr_t G_B109_2;
- memset(&G_B109_2, 0, sizeof(G_B109_2));
- String_t* G_B112_0 = NULL;
- int32_t G_B112_1 = 0;
- intptr_t G_B112_2;
- memset(&G_B112_2, 0, sizeof(G_B112_2));
- String_t* G_B111_0 = NULL;
- int32_t G_B111_1 = 0;
- intptr_t G_B111_2;
- memset(&G_B111_2, 0, sizeof(G_B111_2));
- String_t* G_B114_0 = NULL;
- int32_t G_B114_1 = 0;
- intptr_t G_B114_2;
- memset(&G_B114_2, 0, sizeof(G_B114_2));
- String_t* G_B113_0 = NULL;
- int32_t G_B113_1 = 0;
- intptr_t G_B113_2;
- memset(&G_B113_2, 0, sizeof(G_B113_2));
- String_t* G_B116_0 = NULL;
- int32_t G_B116_1 = 0;
- intptr_t G_B116_2;
- memset(&G_B116_2, 0, sizeof(G_B116_2));
- String_t* G_B115_0 = NULL;
- int32_t G_B115_1 = 0;
- intptr_t G_B115_2;
- memset(&G_B115_2, 0, sizeof(G_B115_2));
- String_t* G_B118_0 = NULL;
- int32_t G_B118_1 = 0;
- intptr_t G_B118_2;
- memset(&G_B118_2, 0, sizeof(G_B118_2));
- String_t* G_B117_0 = NULL;
- int32_t G_B117_1 = 0;
- intptr_t G_B117_2;
- memset(&G_B117_2, 0, sizeof(G_B117_2));
- String_t* G_B120_0 = NULL;
- int32_t G_B120_1 = 0;
- intptr_t G_B120_2;
- memset(&G_B120_2, 0, sizeof(G_B120_2));
- String_t* G_B119_0 = NULL;
- int32_t G_B119_1 = 0;
- intptr_t G_B119_2;
- memset(&G_B119_2, 0, sizeof(G_B119_2));
- String_t* G_B122_0 = NULL;
- int32_t G_B122_1 = 0;
- intptr_t G_B122_2;
- memset(&G_B122_2, 0, sizeof(G_B122_2));
- String_t* G_B121_0 = NULL;
- int32_t G_B121_1 = 0;
- intptr_t G_B121_2;
- memset(&G_B121_2, 0, sizeof(G_B121_2));
- String_t* G_B124_0 = NULL;
- int32_t G_B124_1 = 0;
- intptr_t G_B124_2;
- memset(&G_B124_2, 0, sizeof(G_B124_2));
- String_t* G_B123_0 = NULL;
- int32_t G_B123_1 = 0;
- intptr_t G_B123_2;
- memset(&G_B123_2, 0, sizeof(G_B123_2));
- String_t* G_B126_0 = NULL;
- int32_t G_B126_1 = 0;
- intptr_t G_B126_2;
- memset(&G_B126_2, 0, sizeof(G_B126_2));
- String_t* G_B125_0 = NULL;
- int32_t G_B125_1 = 0;
- intptr_t G_B125_2;
- memset(&G_B125_2, 0, sizeof(G_B125_2));
- String_t* G_B128_0 = NULL;
- int32_t G_B128_1 = 0;
- intptr_t G_B128_2;
- memset(&G_B128_2, 0, sizeof(G_B128_2));
- String_t* G_B127_0 = NULL;
- int32_t G_B127_1 = 0;
- intptr_t G_B127_2;
- memset(&G_B127_2, 0, sizeof(G_B127_2));
- String_t* G_B130_0 = NULL;
- int32_t G_B130_1 = 0;
- intptr_t G_B130_2;
- memset(&G_B130_2, 0, sizeof(G_B130_2));
- String_t* G_B129_0 = NULL;
- int32_t G_B129_1 = 0;
- intptr_t G_B129_2;
- memset(&G_B129_2, 0, sizeof(G_B129_2));
- String_t* G_B132_0 = NULL;
- int32_t G_B132_1 = 0;
- intptr_t G_B132_2;
- memset(&G_B132_2, 0, sizeof(G_B132_2));
- String_t* G_B131_0 = NULL;
- int32_t G_B131_1 = 0;
- intptr_t G_B131_2;
- memset(&G_B131_2, 0, sizeof(G_B131_2));
- String_t* G_B134_0 = NULL;
- int32_t G_B134_1 = 0;
- intptr_t G_B134_2;
- memset(&G_B134_2, 0, sizeof(G_B134_2));
- String_t* G_B133_0 = NULL;
- int32_t G_B133_1 = 0;
- intptr_t G_B133_2;
- memset(&G_B133_2, 0, sizeof(G_B133_2));
- String_t* G_B136_0 = NULL;
- int32_t G_B136_1 = 0;
- intptr_t G_B136_2;
- memset(&G_B136_2, 0, sizeof(G_B136_2));
- String_t* G_B135_0 = NULL;
- int32_t G_B135_1 = 0;
- intptr_t G_B135_2;
- memset(&G_B135_2, 0, sizeof(G_B135_2));
- String_t* G_B138_0 = NULL;
- int32_t G_B138_1 = 0;
- intptr_t G_B138_2;
- memset(&G_B138_2, 0, sizeof(G_B138_2));
- String_t* G_B137_0 = NULL;
- int32_t G_B137_1 = 0;
- intptr_t G_B137_2;
- memset(&G_B137_2, 0, sizeof(G_B137_2));
- String_t* G_B140_0 = NULL;
- int32_t G_B140_1 = 0;
- intptr_t G_B140_2;
- memset(&G_B140_2, 0, sizeof(G_B140_2));
- String_t* G_B139_0 = NULL;
- int32_t G_B139_1 = 0;
- intptr_t G_B139_2;
- memset(&G_B139_2, 0, sizeof(G_B139_2));
- String_t* G_B142_0 = NULL;
- int32_t G_B142_1 = 0;
- intptr_t G_B142_2;
- memset(&G_B142_2, 0, sizeof(G_B142_2));
- String_t* G_B141_0 = NULL;
- int32_t G_B141_1 = 0;
- intptr_t G_B141_2;
- memset(&G_B141_2, 0, sizeof(G_B141_2));
- String_t* G_B144_0 = NULL;
- int32_t G_B144_1 = 0;
- intptr_t G_B144_2;
- memset(&G_B144_2, 0, sizeof(G_B144_2));
- String_t* G_B143_0 = NULL;
- int32_t G_B143_1 = 0;
- intptr_t G_B143_2;
- memset(&G_B143_2, 0, sizeof(G_B143_2));
- String_t* G_B146_0 = NULL;
- int32_t G_B146_1 = 0;
- intptr_t G_B146_2;
- memset(&G_B146_2, 0, sizeof(G_B146_2));
- String_t* G_B145_0 = NULL;
- int32_t G_B145_1 = 0;
- intptr_t G_B145_2;
- memset(&G_B145_2, 0, sizeof(G_B145_2));
- String_t* G_B148_0 = NULL;
- int32_t G_B148_1 = 0;
- intptr_t G_B148_2;
- memset(&G_B148_2, 0, sizeof(G_B148_2));
- String_t* G_B147_0 = NULL;
- int32_t G_B147_1 = 0;
- intptr_t G_B147_2;
- memset(&G_B147_2, 0, sizeof(G_B147_2));
- String_t* G_B150_0 = NULL;
- int32_t G_B150_1 = 0;
- intptr_t G_B150_2;
- memset(&G_B150_2, 0, sizeof(G_B150_2));
- String_t* G_B149_0 = NULL;
- int32_t G_B149_1 = 0;
- intptr_t G_B149_2;
- memset(&G_B149_2, 0, sizeof(G_B149_2));
- String_t* G_B152_0 = NULL;
- int32_t G_B152_1 = 0;
- intptr_t G_B152_2;
- memset(&G_B152_2, 0, sizeof(G_B152_2));
- String_t* G_B151_0 = NULL;
- int32_t G_B151_1 = 0;
- intptr_t G_B151_2;
- memset(&G_B151_2, 0, sizeof(G_B151_2));
- String_t* G_B154_0 = NULL;
- int32_t G_B154_1 = 0;
- intptr_t G_B154_2;
- memset(&G_B154_2, 0, sizeof(G_B154_2));
- String_t* G_B153_0 = NULL;
- int32_t G_B153_1 = 0;
- intptr_t G_B153_2;
- memset(&G_B153_2, 0, sizeof(G_B153_2));
- String_t* G_B156_0 = NULL;
- int32_t G_B156_1 = 0;
- intptr_t G_B156_2;
- memset(&G_B156_2, 0, sizeof(G_B156_2));
- String_t* G_B155_0 = NULL;
- int32_t G_B155_1 = 0;
- intptr_t G_B155_2;
- memset(&G_B155_2, 0, sizeof(G_B155_2));
- String_t* G_B158_0 = NULL;
- int32_t G_B158_1 = 0;
- intptr_t G_B158_2;
- memset(&G_B158_2, 0, sizeof(G_B158_2));
- String_t* G_B157_0 = NULL;
- int32_t G_B157_1 = 0;
- intptr_t G_B157_2;
- memset(&G_B157_2, 0, sizeof(G_B157_2));
- String_t* G_B160_0 = NULL;
- int32_t G_B160_1 = 0;
- intptr_t G_B160_2;
- memset(&G_B160_2, 0, sizeof(G_B160_2));
- String_t* G_B159_0 = NULL;
- int32_t G_B159_1 = 0;
- intptr_t G_B159_2;
- memset(&G_B159_2, 0, sizeof(G_B159_2));
- String_t* G_B162_0 = NULL;
- int32_t G_B162_1 = 0;
- intptr_t G_B162_2;
- memset(&G_B162_2, 0, sizeof(G_B162_2));
- String_t* G_B161_0 = NULL;
- int32_t G_B161_1 = 0;
- intptr_t G_B161_2;
- memset(&G_B161_2, 0, sizeof(G_B161_2));
- String_t* G_B164_0 = NULL;
- int32_t G_B164_1 = 0;
- intptr_t G_B164_2;
- memset(&G_B164_2, 0, sizeof(G_B164_2));
- String_t* G_B163_0 = NULL;
- int32_t G_B163_1 = 0;
- intptr_t G_B163_2;
- memset(&G_B163_2, 0, sizeof(G_B163_2));
- String_t* G_B166_0 = NULL;
- int32_t G_B166_1 = 0;
- intptr_t G_B166_2;
- memset(&G_B166_2, 0, sizeof(G_B166_2));
- String_t* G_B165_0 = NULL;
- int32_t G_B165_1 = 0;
- intptr_t G_B165_2;
- memset(&G_B165_2, 0, sizeof(G_B165_2));
- String_t* G_B168_0 = NULL;
- int32_t G_B168_1 = 0;
- intptr_t G_B168_2;
- memset(&G_B168_2, 0, sizeof(G_B168_2));
- String_t* G_B167_0 = NULL;
- int32_t G_B167_1 = 0;
- intptr_t G_B167_2;
- memset(&G_B167_2, 0, sizeof(G_B167_2));
- String_t* G_B170_0 = NULL;
- int32_t G_B170_1 = 0;
- intptr_t G_B170_2;
- memset(&G_B170_2, 0, sizeof(G_B170_2));
- String_t* G_B169_0 = NULL;
- int32_t G_B169_1 = 0;
- intptr_t G_B169_2;
- memset(&G_B169_2, 0, sizeof(G_B169_2));
- String_t* G_B172_0 = NULL;
- int32_t G_B172_1 = 0;
- intptr_t G_B172_2;
- memset(&G_B172_2, 0, sizeof(G_B172_2));
- String_t* G_B171_0 = NULL;
- int32_t G_B171_1 = 0;
- intptr_t G_B171_2;
- memset(&G_B171_2, 0, sizeof(G_B171_2));
- intptr_t G_B174_0;
- memset(&G_B174_0, 0, sizeof(G_B174_0));
- Type_t * G_B174_1 = NULL;
- intptr_t G_B173_0;
- memset(&G_B173_0, 0, sizeof(G_B173_0));
- Type_t * G_B173_1 = NULL;
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- RuntimeTypeHandle_t3027515415 L_3 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_4 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- Type_t * L_5 = V_1;
- intptr_t L_6 = ___L0;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- Utils_BeginObjectRegister_m972381667(NULL /*static, unused*/, L_5, L_6, L_7, 0, ((int32_t)54), ((int32_t)19), ((int32_t)13), (-1), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- lua_CSFunction_t883524059 * L_9 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- G_B1_0 = _stringLiteral631211784;
- G_B1_1 = ((int32_t)-3);
- G_B1_2 = L_8;
- if (L_9)
- {
- G_B2_0 = _stringLiteral631211784;
- G_B2_1 = ((int32_t)-3);
- G_B2_2 = L_8;
- goto IL_0047;
- }
- }
- {
- intptr_t L_10 = (intptr_t)UnityEngineTransformWrap__m_SetParent_m804936730_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_11 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_11, NULL, L_10, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache0_0(L_11);
- G_B2_0 = G_B1_0;
- G_B2_1 = G_B1_1;
- G_B2_2 = G_B1_2;
- }
- IL_0047:
- {
- lua_CSFunction_t883524059 * L_12 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B2_2, G_B2_1, G_B2_0, L_12, /*hidden argument*/NULL);
- intptr_t L_13 = ___L0;
- lua_CSFunction_t883524059 * L_14 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- G_B3_0 = _stringLiteral2941355937;
- G_B3_1 = ((int32_t)-3);
- G_B3_2 = L_13;
- if (L_14)
- {
- G_B4_0 = _stringLiteral2941355937;
- G_B4_1 = ((int32_t)-3);
- G_B4_2 = L_13;
- goto IL_0071;
- }
- }
- {
- intptr_t L_15 = (intptr_t)UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_16 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_16, NULL, L_15, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1_1(L_16);
- G_B4_0 = G_B3_0;
- G_B4_1 = G_B3_1;
- G_B4_2 = G_B3_2;
- }
- IL_0071:
- {
- lua_CSFunction_t883524059 * L_17 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B4_2, G_B4_1, G_B4_0, L_17, /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- lua_CSFunction_t883524059 * L_19 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- G_B5_0 = _stringLiteral547368030;
- G_B5_1 = ((int32_t)-3);
- G_B5_2 = L_18;
- if (L_19)
- {
- G_B6_0 = _stringLiteral547368030;
- G_B6_1 = ((int32_t)-3);
- G_B6_2 = L_18;
- goto IL_009b;
- }
- }
- {
- intptr_t L_20 = (intptr_t)UnityEngineTransformWrap__m_Translate_m975680681_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_21 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_21, NULL, L_20, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2_2(L_21);
- G_B6_0 = G_B5_0;
- G_B6_1 = G_B5_1;
- G_B6_2 = G_B5_2;
- }
- IL_009b:
- {
- lua_CSFunction_t883524059 * L_22 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B6_2, G_B6_1, G_B6_0, L_22, /*hidden argument*/NULL);
- intptr_t L_23 = ___L0;
- lua_CSFunction_t883524059 * L_24 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- G_B7_0 = _stringLiteral845267518;
- G_B7_1 = ((int32_t)-3);
- G_B7_2 = L_23;
- if (L_24)
- {
- G_B8_0 = _stringLiteral845267518;
- G_B8_1 = ((int32_t)-3);
- G_B8_2 = L_23;
- goto IL_00c5;
- }
- }
- {
- intptr_t L_25 = (intptr_t)UnityEngineTransformWrap__m_Rotate_m1066480346_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_26 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_26, NULL, L_25, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3_3(L_26);
- G_B8_0 = G_B7_0;
- G_B8_1 = G_B7_1;
- G_B8_2 = G_B7_2;
- }
- IL_00c5:
- {
- lua_CSFunction_t883524059 * L_27 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B8_2, G_B8_1, G_B8_0, L_27, /*hidden argument*/NULL);
- intptr_t L_28 = ___L0;
- lua_CSFunction_t883524059 * L_29 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- G_B9_0 = _stringLiteral316676394;
- G_B9_1 = ((int32_t)-3);
- G_B9_2 = L_28;
- if (L_29)
- {
- G_B10_0 = _stringLiteral316676394;
- G_B10_1 = ((int32_t)-3);
- G_B10_2 = L_28;
- goto IL_00ef;
- }
- }
- {
- intptr_t L_30 = (intptr_t)UnityEngineTransformWrap__m_RotateAround_m3000108533_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_31 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_31, NULL, L_30, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4_4(L_31);
- G_B10_0 = G_B9_0;
- G_B10_1 = G_B9_1;
- G_B10_2 = G_B9_2;
- }
- IL_00ef:
- {
- lua_CSFunction_t883524059 * L_32 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B10_2, G_B10_1, G_B10_0, L_32, /*hidden argument*/NULL);
- intptr_t L_33 = ___L0;
- lua_CSFunction_t883524059 * L_34 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- G_B11_0 = _stringLiteral1944240872;
- G_B11_1 = ((int32_t)-3);
- G_B11_2 = L_33;
- if (L_34)
- {
- G_B12_0 = _stringLiteral1944240872;
- G_B12_1 = ((int32_t)-3);
- G_B12_2 = L_33;
- goto IL_0119;
- }
- }
- {
- intptr_t L_35 = (intptr_t)UnityEngineTransformWrap__m_LookAt_m1878060840_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_36 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_36, NULL, L_35, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache5_5(L_36);
- G_B12_0 = G_B11_0;
- G_B12_1 = G_B11_1;
- G_B12_2 = G_B11_2;
- }
- IL_0119:
- {
- lua_CSFunction_t883524059 * L_37 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B12_2, G_B12_1, G_B12_0, L_37, /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- lua_CSFunction_t883524059 * L_39 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- G_B13_0 = _stringLiteral2632091121;
- G_B13_1 = ((int32_t)-3);
- G_B13_2 = L_38;
- if (L_39)
- {
- G_B14_0 = _stringLiteral2632091121;
- G_B14_1 = ((int32_t)-3);
- G_B14_2 = L_38;
- goto IL_0143;
- }
- }
- {
- intptr_t L_40 = (intptr_t)UnityEngineTransformWrap__m_TransformDirection_m4138306096_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_41 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_41, NULL, L_40, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache6_6(L_41);
- G_B14_0 = G_B13_0;
- G_B14_1 = G_B13_1;
- G_B14_2 = G_B13_2;
- }
- IL_0143:
- {
- lua_CSFunction_t883524059 * L_42 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B14_2, G_B14_1, G_B14_0, L_42, /*hidden argument*/NULL);
- intptr_t L_43 = ___L0;
- lua_CSFunction_t883524059 * L_44 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- G_B15_0 = _stringLiteral771426467;
- G_B15_1 = ((int32_t)-3);
- G_B15_2 = L_43;
- if (L_44)
- {
- G_B16_0 = _stringLiteral771426467;
- G_B16_1 = ((int32_t)-3);
- G_B16_2 = L_43;
- goto IL_016d;
- }
- }
- {
- intptr_t L_45 = (intptr_t)UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_46 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_46, NULL, L_45, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache7_7(L_46);
- G_B16_0 = G_B15_0;
- G_B16_1 = G_B15_1;
- G_B16_2 = G_B15_2;
- }
- IL_016d:
- {
- lua_CSFunction_t883524059 * L_47 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B16_2, G_B16_1, G_B16_0, L_47, /*hidden argument*/NULL);
- intptr_t L_48 = ___L0;
- lua_CSFunction_t883524059 * L_49 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- G_B17_0 = _stringLiteral1724311596;
- G_B17_1 = ((int32_t)-3);
- G_B17_2 = L_48;
- if (L_49)
- {
- G_B18_0 = _stringLiteral1724311596;
- G_B18_1 = ((int32_t)-3);
- G_B18_2 = L_48;
- goto IL_0197;
- }
- }
- {
- intptr_t L_50 = (intptr_t)UnityEngineTransformWrap__m_TransformVector_m1514244944_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_51 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_51, NULL, L_50, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache8_8(L_51);
- G_B18_0 = G_B17_0;
- G_B18_1 = G_B17_1;
- G_B18_2 = G_B17_2;
- }
- IL_0197:
- {
- lua_CSFunction_t883524059 * L_52 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B18_2, G_B18_1, G_B18_0, L_52, /*hidden argument*/NULL);
- intptr_t L_53 = ___L0;
- lua_CSFunction_t883524059 * L_54 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- G_B19_0 = _stringLiteral3292596422;
- G_B19_1 = ((int32_t)-3);
- G_B19_2 = L_53;
- if (L_54)
- {
- G_B20_0 = _stringLiteral3292596422;
- G_B20_1 = ((int32_t)-3);
- G_B20_2 = L_53;
- goto IL_01c1;
- }
- }
- {
- intptr_t L_55 = (intptr_t)UnityEngineTransformWrap__m_InverseTransformVector_m1349495655_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_56 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_56, NULL, L_55, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache9_9(L_56);
- G_B20_0 = G_B19_0;
- G_B20_1 = G_B19_1;
- G_B20_2 = G_B19_2;
- }
- IL_01c1:
- {
- lua_CSFunction_t883524059 * L_57 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B20_2, G_B20_1, G_B20_0, L_57, /*hidden argument*/NULL);
- intptr_t L_58 = ___L0;
- lua_CSFunction_t883524059 * L_59 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- G_B21_0 = _stringLiteral3530984291;
- G_B21_1 = ((int32_t)-3);
- G_B21_2 = L_58;
- if (L_59)
- {
- G_B22_0 = _stringLiteral3530984291;
- G_B22_1 = ((int32_t)-3);
- G_B22_2 = L_58;
- goto IL_01eb;
- }
- }
- {
- intptr_t L_60 = (intptr_t)UnityEngineTransformWrap__m_TransformPoint_m1078881144_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_61 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_61, NULL, L_60, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheA_10(L_61);
- G_B22_0 = G_B21_0;
- G_B22_1 = G_B21_1;
- G_B22_2 = G_B21_2;
- }
- IL_01eb:
- {
- lua_CSFunction_t883524059 * L_62 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B22_2, G_B22_1, G_B22_0, L_62, /*hidden argument*/NULL);
- intptr_t L_63 = ___L0;
- lua_CSFunction_t883524059 * L_64 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- G_B23_0 = _stringLiteral553894831;
- G_B23_1 = ((int32_t)-3);
- G_B23_2 = L_63;
- if (L_64)
- {
- G_B24_0 = _stringLiteral553894831;
- G_B24_1 = ((int32_t)-3);
- G_B24_2 = L_63;
- goto IL_0215;
- }
- }
- {
- intptr_t L_65 = (intptr_t)UnityEngineTransformWrap__m_InverseTransformPoint_m957968118_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_66 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_66, NULL, L_65, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheB_11(L_66);
- G_B24_0 = G_B23_0;
- G_B24_1 = G_B23_1;
- G_B24_2 = G_B23_2;
- }
- IL_0215:
- {
- lua_CSFunction_t883524059 * L_67 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B24_2, G_B24_1, G_B24_0, L_67, /*hidden argument*/NULL);
- intptr_t L_68 = ___L0;
- lua_CSFunction_t883524059 * L_69 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- G_B25_0 = _stringLiteral897953071;
- G_B25_1 = ((int32_t)-3);
- G_B25_2 = L_68;
- if (L_69)
- {
- G_B26_0 = _stringLiteral897953071;
- G_B26_1 = ((int32_t)-3);
- G_B26_2 = L_68;
- goto IL_023f;
- }
- }
- {
- intptr_t L_70 = (intptr_t)UnityEngineTransformWrap__m_DetachChildren_m520041245_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_71 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_71, NULL, L_70, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheC_12(L_71);
- G_B26_0 = G_B25_0;
- G_B26_1 = G_B25_1;
- G_B26_2 = G_B25_2;
- }
- IL_023f:
- {
- lua_CSFunction_t883524059 * L_72 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B26_2, G_B26_1, G_B26_0, L_72, /*hidden argument*/NULL);
- intptr_t L_73 = ___L0;
- lua_CSFunction_t883524059 * L_74 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- G_B27_0 = _stringLiteral904694020;
- G_B27_1 = ((int32_t)-3);
- G_B27_2 = L_73;
- if (L_74)
- {
- G_B28_0 = _stringLiteral904694020;
- G_B28_1 = ((int32_t)-3);
- G_B28_2 = L_73;
- goto IL_0269;
- }
- }
- {
- intptr_t L_75 = (intptr_t)UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_76 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_76, NULL, L_75, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheD_13(L_76);
- G_B28_0 = G_B27_0;
- G_B28_1 = G_B27_1;
- G_B28_2 = G_B27_2;
- }
- IL_0269:
- {
- lua_CSFunction_t883524059 * L_77 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B28_2, G_B28_1, G_B28_0, L_77, /*hidden argument*/NULL);
- intptr_t L_78 = ___L0;
- lua_CSFunction_t883524059 * L_79 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- G_B29_0 = _stringLiteral1184080547;
- G_B29_1 = ((int32_t)-3);
- G_B29_2 = L_78;
- if (L_79)
- {
- G_B30_0 = _stringLiteral1184080547;
- G_B30_1 = ((int32_t)-3);
- G_B30_2 = L_78;
- goto IL_0293;
- }
- }
- {
- intptr_t L_80 = (intptr_t)UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_81 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_81, NULL, L_80, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheE_14(L_81);
- G_B30_0 = G_B29_0;
- G_B30_1 = G_B29_1;
- G_B30_2 = G_B29_2;
- }
- IL_0293:
- {
- lua_CSFunction_t883524059 * L_82 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B30_2, G_B30_1, G_B30_0, L_82, /*hidden argument*/NULL);
- intptr_t L_83 = ___L0;
- lua_CSFunction_t883524059 * L_84 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- G_B31_0 = _stringLiteral407814805;
- G_B31_1 = ((int32_t)-3);
- G_B31_2 = L_83;
- if (L_84)
- {
- G_B32_0 = _stringLiteral407814805;
- G_B32_1 = ((int32_t)-3);
- G_B32_2 = L_83;
- goto IL_02bd;
- }
- }
- {
- intptr_t L_85 = (intptr_t)UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_86 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_86, NULL, L_85, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheF_15(L_86);
- G_B32_0 = G_B31_0;
- G_B32_1 = G_B31_1;
- G_B32_2 = G_B31_2;
- }
- IL_02bd:
- {
- lua_CSFunction_t883524059 * L_87 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B32_2, G_B32_1, G_B32_0, L_87, /*hidden argument*/NULL);
- intptr_t L_88 = ___L0;
- lua_CSFunction_t883524059 * L_89 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- G_B33_0 = _stringLiteral407711105;
- G_B33_1 = ((int32_t)-3);
- G_B33_2 = L_88;
- if (L_89)
- {
- G_B34_0 = _stringLiteral407711105;
- G_B34_1 = ((int32_t)-3);
- G_B34_2 = L_88;
- goto IL_02e7;
- }
- }
- {
- intptr_t L_90 = (intptr_t)UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_91 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_91, NULL, L_90, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache10_16(L_91);
- G_B34_0 = G_B33_0;
- G_B34_1 = G_B33_1;
- G_B34_2 = G_B33_2;
- }
- IL_02e7:
- {
- lua_CSFunction_t883524059 * L_92 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B34_2, G_B34_1, G_B34_0, L_92, /*hidden argument*/NULL);
- intptr_t L_93 = ___L0;
- lua_CSFunction_t883524059 * L_94 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- G_B35_0 = _stringLiteral835817774;
- G_B35_1 = ((int32_t)-3);
- G_B35_2 = L_93;
- if (L_94)
- {
- G_B36_0 = _stringLiteral835817774;
- G_B36_1 = ((int32_t)-3);
- G_B36_2 = L_93;
- goto IL_0311;
- }
- }
- {
- intptr_t L_95 = (intptr_t)UnityEngineTransformWrap__m_Find_m1578719640_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_96 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_96, NULL, L_95, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache11_17(L_96);
- G_B36_0 = G_B35_0;
- G_B36_1 = G_B35_1;
- G_B36_2 = G_B35_2;
- }
- IL_0311:
- {
- lua_CSFunction_t883524059 * L_97 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B36_2, G_B36_1, G_B36_0, L_97, /*hidden argument*/NULL);
- intptr_t L_98 = ___L0;
- lua_CSFunction_t883524059 * L_99 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache12_18();
- G_B37_0 = _stringLiteral3733432723;
- G_B37_1 = ((int32_t)-3);
- G_B37_2 = L_98;
- if (L_99)
- {
- G_B38_0 = _stringLiteral3733432723;
- G_B38_1 = ((int32_t)-3);
- G_B38_2 = L_98;
- goto IL_033b;
- }
- }
- {
- intptr_t L_100 = (intptr_t)UnityEngineTransformWrap__m_IsChildOf_m764668816_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_101 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_101, NULL, L_100, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache12_18(L_101);
- G_B38_0 = G_B37_0;
- G_B38_1 = G_B37_1;
- G_B38_2 = G_B37_2;
- }
- IL_033b:
- {
- lua_CSFunction_t883524059 * L_102 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache12_18();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B38_2, G_B38_1, G_B38_0, L_102, /*hidden argument*/NULL);
- intptr_t L_103 = ___L0;
- lua_CSFunction_t883524059 * L_104 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache13_19();
- G_B39_0 = _stringLiteral3024845674;
- G_B39_1 = ((int32_t)-3);
- G_B39_2 = L_103;
- if (L_104)
- {
- G_B40_0 = _stringLiteral3024845674;
- G_B40_1 = ((int32_t)-3);
- G_B40_2 = L_103;
- goto IL_0365;
- }
- }
- {
- intptr_t L_105 = (intptr_t)UnityEngineTransformWrap__m_GetEnumerator_m2850786488_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_106 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_106, NULL, L_105, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache13_19(L_106);
- G_B40_0 = G_B39_0;
- G_B40_1 = G_B39_1;
- G_B40_2 = G_B39_2;
- }
- IL_0365:
- {
- lua_CSFunction_t883524059 * L_107 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache13_19();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B40_2, G_B40_1, G_B40_0, L_107, /*hidden argument*/NULL);
- intptr_t L_108 = ___L0;
- lua_CSFunction_t883524059 * L_109 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache14_20();
- G_B41_0 = _stringLiteral797258743;
- G_B41_1 = ((int32_t)-3);
- G_B41_2 = L_108;
- if (L_109)
- {
- G_B42_0 = _stringLiteral797258743;
- G_B42_1 = ((int32_t)-3);
- G_B42_2 = L_108;
- goto IL_038f;
- }
- }
- {
- intptr_t L_110 = (intptr_t)UnityEngineTransformWrap__m_GetChild_m1976232125_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_111 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_111, NULL, L_110, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache14_20(L_111);
- G_B42_0 = G_B41_0;
- G_B42_1 = G_B41_1;
- G_B42_2 = G_B41_2;
- }
- IL_038f:
- {
- lua_CSFunction_t883524059 * L_112 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache14_20();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B42_2, G_B42_1, G_B42_0, L_112, /*hidden argument*/NULL);
- intptr_t L_113 = ___L0;
- lua_CSFunction_t883524059 * L_114 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache15_21();
- G_B43_0 = _stringLiteral2952807841;
- G_B43_1 = ((int32_t)-3);
- G_B43_2 = L_113;
- if (L_114)
- {
- G_B44_0 = _stringLiteral2952807841;
- G_B44_1 = ((int32_t)-3);
- G_B44_2 = L_113;
- goto IL_03b9;
- }
- }
- {
- intptr_t L_115 = (intptr_t)UnityEngineTransformWrap__m_DOMove_m2510464153_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_116 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_116, NULL, L_115, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache15_21(L_116);
- G_B44_0 = G_B43_0;
- G_B44_1 = G_B43_1;
- G_B44_2 = G_B43_2;
- }
- IL_03b9:
- {
- lua_CSFunction_t883524059 * L_117 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache15_21();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B44_2, G_B44_1, G_B44_0, L_117, /*hidden argument*/NULL);
- intptr_t L_118 = ___L0;
- lua_CSFunction_t883524059 * L_119 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache16_22();
- G_B45_0 = _stringLiteral3451201703;
- G_B45_1 = ((int32_t)-3);
- G_B45_2 = L_118;
- if (L_119)
- {
- G_B46_0 = _stringLiteral3451201703;
- G_B46_1 = ((int32_t)-3);
- G_B46_2 = L_118;
- goto IL_03e3;
- }
- }
- {
- intptr_t L_120 = (intptr_t)UnityEngineTransformWrap__m_DOMoveX_m427706497_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_121 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_121, NULL, L_120, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache16_22(L_121);
- G_B46_0 = G_B45_0;
- G_B46_1 = G_B45_1;
- G_B46_2 = G_B45_2;
- }
- IL_03e3:
- {
- lua_CSFunction_t883524059 * L_122 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache16_22();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B46_2, G_B46_1, G_B46_0, L_122, /*hidden argument*/NULL);
- intptr_t L_123 = ___L0;
- lua_CSFunction_t883524059 * L_124 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache17_23();
- G_B47_0 = _stringLiteral722318348;
- G_B47_1 = ((int32_t)-3);
- G_B47_2 = L_123;
- if (L_124)
- {
- G_B48_0 = _stringLiteral722318348;
- G_B48_1 = ((int32_t)-3);
- G_B48_2 = L_123;
- goto IL_040d;
- }
- }
- {
- intptr_t L_125 = (intptr_t)UnityEngineTransformWrap__m_DOMoveY_m3829814726_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_126 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_126, NULL, L_125, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache17_23(L_126);
- G_B48_0 = G_B47_0;
- G_B48_1 = G_B47_1;
- G_B48_2 = G_B47_2;
- }
- IL_040d:
- {
- lua_CSFunction_t883524059 * L_127 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache17_23();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B48_2, G_B48_1, G_B48_0, L_127, /*hidden argument*/NULL);
- intptr_t L_128 = ___L0;
- lua_CSFunction_t883524059 * L_129 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache18_24();
- G_B49_0 = _stringLiteral2288402289;
- G_B49_1 = ((int32_t)-3);
- G_B49_2 = L_128;
- if (L_129)
- {
- G_B50_0 = _stringLiteral2288402289;
- G_B50_1 = ((int32_t)-3);
- G_B50_2 = L_128;
- goto IL_0437;
- }
- }
- {
- intptr_t L_130 = (intptr_t)UnityEngineTransformWrap__m_DOMoveZ_m3431864067_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_131 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_131, NULL, L_130, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache18_24(L_131);
- G_B50_0 = G_B49_0;
- G_B50_1 = G_B49_1;
- G_B50_2 = G_B49_2;
- }
- IL_0437:
- {
- lua_CSFunction_t883524059 * L_132 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache18_24();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B50_2, G_B50_1, G_B50_0, L_132, /*hidden argument*/NULL);
- intptr_t L_133 = ___L0;
- lua_CSFunction_t883524059 * L_134 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache19_25();
- G_B51_0 = _stringLiteral1495791138;
- G_B51_1 = ((int32_t)-3);
- G_B51_2 = L_133;
- if (L_134)
- {
- G_B52_0 = _stringLiteral1495791138;
- G_B52_1 = ((int32_t)-3);
- G_B52_2 = L_133;
- goto IL_0461;
- }
- }
- {
- intptr_t L_135 = (intptr_t)UnityEngineTransformWrap__m_DOLocalMove_m602687662_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_136 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_136, NULL, L_135, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache19_25(L_136);
- G_B52_0 = G_B51_0;
- G_B52_1 = G_B51_1;
- G_B52_2 = G_B51_2;
- }
- IL_0461:
- {
- lua_CSFunction_t883524059 * L_137 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache19_25();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B52_2, G_B52_1, G_B52_0, L_137, /*hidden argument*/NULL);
- intptr_t L_138 = ___L0;
- lua_CSFunction_t883524059 * L_139 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1A_26();
- G_B53_0 = _stringLiteral2438985250;
- G_B53_1 = ((int32_t)-3);
- G_B53_2 = L_138;
- if (L_139)
- {
- G_B54_0 = _stringLiteral2438985250;
- G_B54_1 = ((int32_t)-3);
- G_B54_2 = L_138;
- goto IL_048b;
- }
- }
- {
- intptr_t L_140 = (intptr_t)UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_141 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_141, NULL, L_140, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1A_26(L_141);
- G_B54_0 = G_B53_0;
- G_B54_1 = G_B53_1;
- G_B54_2 = G_B53_2;
- }
- IL_048b:
- {
- lua_CSFunction_t883524059 * L_142 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1A_26();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B54_2, G_B54_1, G_B54_0, L_142, /*hidden argument*/NULL);
- intptr_t L_143 = ___L0;
- lua_CSFunction_t883524059 * L_144 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1B_27();
- G_B55_0 = _stringLiteral482670114;
- G_B55_1 = ((int32_t)-3);
- G_B55_2 = L_143;
- if (L_144)
- {
- G_B56_0 = _stringLiteral482670114;
- G_B56_1 = ((int32_t)-3);
- G_B56_2 = L_143;
- goto IL_04b5;
- }
- }
- {
- intptr_t L_145 = (intptr_t)UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_146 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_146, NULL, L_145, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1B_27(L_146);
- G_B56_0 = G_B55_0;
- G_B56_1 = G_B55_1;
- G_B56_2 = G_B55_2;
- }
- IL_04b5:
- {
- lua_CSFunction_t883524059 * L_147 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1B_27();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B56_2, G_B56_1, G_B56_0, L_147, /*hidden argument*/NULL);
- intptr_t L_148 = ___L0;
- lua_CSFunction_t883524059 * L_149 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1C_28();
- G_B57_0 = _stringLiteral2821322274;
- G_B57_1 = ((int32_t)-3);
- G_B57_2 = L_148;
- if (L_149)
- {
- G_B58_0 = _stringLiteral2821322274;
- G_B58_1 = ((int32_t)-3);
- G_B58_2 = L_148;
- goto IL_04df;
- }
- }
- {
- intptr_t L_150 = (intptr_t)UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_151 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_151, NULL, L_150, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1C_28(L_151);
- G_B58_0 = G_B57_0;
- G_B58_1 = G_B57_1;
- G_B58_2 = G_B57_2;
- }
- IL_04df:
- {
- lua_CSFunction_t883524059 * L_152 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1C_28();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B58_2, G_B58_1, G_B58_0, L_152, /*hidden argument*/NULL);
- intptr_t L_153 = ___L0;
- lua_CSFunction_t883524059 * L_154 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1D_29();
- G_B59_0 = _stringLiteral979177448;
- G_B59_1 = ((int32_t)-3);
- G_B59_2 = L_153;
- if (L_154)
- {
- G_B60_0 = _stringLiteral979177448;
- G_B60_1 = ((int32_t)-3);
- G_B60_2 = L_153;
- goto IL_0509;
- }
- }
- {
- intptr_t L_155 = (intptr_t)UnityEngineTransformWrap__m_DORotate_m825617719_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_156 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_156, NULL, L_155, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1D_29(L_156);
- G_B60_0 = G_B59_0;
- G_B60_1 = G_B59_1;
- G_B60_2 = G_B59_2;
- }
- IL_0509:
- {
- lua_CSFunction_t883524059 * L_157 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1D_29();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B60_2, G_B60_1, G_B60_0, L_157, /*hidden argument*/NULL);
- intptr_t L_158 = ___L0;
- lua_CSFunction_t883524059 * L_159 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1E_30();
- G_B61_0 = _stringLiteral894585886;
- G_B61_1 = ((int32_t)-3);
- G_B61_2 = L_158;
- if (L_159)
- {
- G_B62_0 = _stringLiteral894585886;
- G_B62_1 = ((int32_t)-3);
- G_B62_2 = L_158;
- goto IL_0533;
- }
- }
- {
- intptr_t L_160 = (intptr_t)UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_161 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_161, NULL, L_160, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1E_30(L_161);
- G_B62_0 = G_B61_0;
- G_B62_1 = G_B61_1;
- G_B62_2 = G_B61_2;
- }
- IL_0533:
- {
- lua_CSFunction_t883524059 * L_162 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1E_30();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B62_2, G_B62_1, G_B62_0, L_162, /*hidden argument*/NULL);
- intptr_t L_163 = ___L0;
- lua_CSFunction_t883524059 * L_164 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1F_31();
- G_B63_0 = _stringLiteral2997256641;
- G_B63_1 = ((int32_t)-3);
- G_B63_2 = L_163;
- if (L_164)
- {
- G_B64_0 = _stringLiteral2997256641;
- G_B64_1 = ((int32_t)-3);
- G_B64_2 = L_163;
- goto IL_055d;
- }
- }
- {
- intptr_t L_165 = (intptr_t)UnityEngineTransformWrap__m_DOLocalRotate_m4095437176_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_166 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_166, NULL, L_165, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1F_31(L_166);
- G_B64_0 = G_B63_0;
- G_B64_1 = G_B63_1;
- G_B64_2 = G_B63_2;
- }
- IL_055d:
- {
- lua_CSFunction_t883524059 * L_167 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1F_31();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B64_2, G_B64_1, G_B64_0, L_167, /*hidden argument*/NULL);
- intptr_t L_168 = ___L0;
- lua_CSFunction_t883524059 * L_169 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache20_32();
- G_B65_0 = _stringLiteral4072772396;
- G_B65_1 = ((int32_t)-3);
- G_B65_2 = L_168;
- if (L_169)
- {
- G_B66_0 = _stringLiteral4072772396;
- G_B66_1 = ((int32_t)-3);
- G_B66_2 = L_168;
- goto IL_0587;
- }
- }
- {
- intptr_t L_170 = (intptr_t)UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_171 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_171, NULL, L_170, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache20_32(L_171);
- G_B66_0 = G_B65_0;
- G_B66_1 = G_B65_1;
- G_B66_2 = G_B65_2;
- }
- IL_0587:
- {
- lua_CSFunction_t883524059 * L_172 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache20_32();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B66_2, G_B66_1, G_B66_0, L_172, /*hidden argument*/NULL);
- intptr_t L_173 = ___L0;
- lua_CSFunction_t883524059 * L_174 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache21_33();
- G_B67_0 = _stringLiteral4241776963;
- G_B67_1 = ((int32_t)-3);
- G_B67_2 = L_173;
- if (L_174)
- {
- G_B68_0 = _stringLiteral4241776963;
- G_B68_1 = ((int32_t)-3);
- G_B68_2 = L_173;
- goto IL_05b1;
- }
- }
- {
- intptr_t L_175 = (intptr_t)UnityEngineTransformWrap__m_DOScale_m1896281278_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_176 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_176, NULL, L_175, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache21_33(L_176);
- G_B68_0 = G_B67_0;
- G_B68_1 = G_B67_1;
- G_B68_2 = G_B67_2;
- }
- IL_05b1:
- {
- lua_CSFunction_t883524059 * L_177 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache21_33();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B68_2, G_B68_1, G_B68_0, L_177, /*hidden argument*/NULL);
- intptr_t L_178 = ___L0;
- lua_CSFunction_t883524059 * L_179 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache22_34();
- G_B69_0 = _stringLiteral303849795;
- G_B69_1 = ((int32_t)-3);
- G_B69_2 = L_178;
- if (L_179)
- {
- G_B70_0 = _stringLiteral303849795;
- G_B70_1 = ((int32_t)-3);
- G_B70_2 = L_178;
- goto IL_05db;
- }
- }
- {
- intptr_t L_180 = (intptr_t)UnityEngineTransformWrap__m_DOScaleX_m2063790813_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_181 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_181, NULL, L_180, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache22_34(L_181);
- G_B70_0 = G_B69_0;
- G_B70_1 = G_B69_1;
- G_B70_2 = G_B69_2;
- }
- IL_05db:
- {
- lua_CSFunction_t883524059 * L_182 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache22_34();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B70_2, G_B70_1, G_B70_0, L_182, /*hidden argument*/NULL);
- intptr_t L_183 = ___L0;
- lua_CSFunction_t883524059 * L_184 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache23_35();
- G_B71_0 = _stringLiteral2260164931;
- G_B71_1 = ((int32_t)-3);
- G_B71_2 = L_183;
- if (L_184)
- {
- G_B72_0 = _stringLiteral2260164931;
- G_B72_1 = ((int32_t)-3);
- G_B72_2 = L_183;
- goto IL_0605;
- }
- }
- {
- intptr_t L_185 = (intptr_t)UnityEngineTransformWrap__m_DOScaleY_m3874994172_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_186 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_186, NULL, L_185, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache23_35(L_186);
- G_B72_0 = G_B71_0;
- G_B72_1 = G_B71_1;
- G_B72_2 = G_B71_2;
- }
- IL_0605:
- {
- lua_CSFunction_t883524059 * L_187 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache23_35();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B72_2, G_B72_1, G_B72_0, L_187, /*hidden argument*/NULL);
- intptr_t L_188 = ___L0;
- lua_CSFunction_t883524059 * L_189 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache24_36();
- G_B73_0 = _stringLiteral4216480067;
- G_B73_1 = ((int32_t)-3);
- G_B73_2 = L_188;
- if (L_189)
- {
- G_B74_0 = _stringLiteral4216480067;
- G_B74_1 = ((int32_t)-3);
- G_B74_2 = L_188;
- goto IL_062f;
- }
- }
- {
- intptr_t L_190 = (intptr_t)UnityEngineTransformWrap__m_DOScaleZ_m976566461_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_191 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_191, NULL, L_190, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache24_36(L_191);
- G_B74_0 = G_B73_0;
- G_B74_1 = G_B73_1;
- G_B74_2 = G_B73_2;
- }
- IL_062f:
- {
- lua_CSFunction_t883524059 * L_192 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache24_36();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B74_2, G_B74_1, G_B74_0, L_192, /*hidden argument*/NULL);
- intptr_t L_193 = ___L0;
- lua_CSFunction_t883524059 * L_194 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache25_37();
- G_B75_0 = _stringLiteral3148468566;
- G_B75_1 = ((int32_t)-3);
- G_B75_2 = L_193;
- if (L_194)
- {
- G_B76_0 = _stringLiteral3148468566;
- G_B76_1 = ((int32_t)-3);
- G_B76_2 = L_193;
- goto IL_0659;
- }
- }
- {
- intptr_t L_195 = (intptr_t)UnityEngineTransformWrap__m_DOLookAt_m89020156_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_196 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_196, NULL, L_195, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache25_37(L_196);
- G_B76_0 = G_B75_0;
- G_B76_1 = G_B75_1;
- G_B76_2 = G_B75_2;
- }
- IL_0659:
- {
- lua_CSFunction_t883524059 * L_197 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache25_37();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B76_2, G_B76_1, G_B76_0, L_197, /*hidden argument*/NULL);
- intptr_t L_198 = ___L0;
- lua_CSFunction_t883524059 * L_199 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache26_38();
- G_B77_0 = _stringLiteral2444761646;
- G_B77_1 = ((int32_t)-3);
- G_B77_2 = L_198;
- if (L_199)
- {
- G_B78_0 = _stringLiteral2444761646;
- G_B78_1 = ((int32_t)-3);
- G_B78_2 = L_198;
- goto IL_0683;
- }
- }
- {
- intptr_t L_200 = (intptr_t)UnityEngineTransformWrap__m_DOPunchPosition_m1266900073_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_201 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_201, NULL, L_200, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache26_38(L_201);
- G_B78_0 = G_B77_0;
- G_B78_1 = G_B77_1;
- G_B78_2 = G_B77_2;
- }
- IL_0683:
- {
- lua_CSFunction_t883524059 * L_202 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache26_38();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B78_2, G_B78_1, G_B78_0, L_202, /*hidden argument*/NULL);
- intptr_t L_203 = ___L0;
- lua_CSFunction_t883524059 * L_204 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache27_39();
- G_B79_0 = _stringLiteral2664994817;
- G_B79_1 = ((int32_t)-3);
- G_B79_2 = L_203;
- if (L_204)
- {
- G_B80_0 = _stringLiteral2664994817;
- G_B80_1 = ((int32_t)-3);
- G_B80_2 = L_203;
- goto IL_06ad;
- }
- }
- {
- intptr_t L_205 = (intptr_t)UnityEngineTransformWrap__m_DOPunchScale_m2535020043_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_206 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_206, NULL, L_205, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache27_39(L_206);
- G_B80_0 = G_B79_0;
- G_B80_1 = G_B79_1;
- G_B80_2 = G_B79_2;
- }
- IL_06ad:
- {
- lua_CSFunction_t883524059 * L_207 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache27_39();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B80_2, G_B80_1, G_B80_0, L_207, /*hidden argument*/NULL);
- intptr_t L_208 = ___L0;
- lua_CSFunction_t883524059 * L_209 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache28_40();
- G_B81_0 = _stringLiteral320213078;
- G_B81_1 = ((int32_t)-3);
- G_B81_2 = L_208;
- if (L_209)
- {
- G_B82_0 = _stringLiteral320213078;
- G_B82_1 = ((int32_t)-3);
- G_B82_2 = L_208;
- goto IL_06d7;
- }
- }
- {
- intptr_t L_210 = (intptr_t)UnityEngineTransformWrap__m_DOPunchRotation_m3158922004_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_211 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_211, NULL, L_210, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache28_40(L_211);
- G_B82_0 = G_B81_0;
- G_B82_1 = G_B81_1;
- G_B82_2 = G_B81_2;
- }
- IL_06d7:
- {
- lua_CSFunction_t883524059 * L_212 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache28_40();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B82_2, G_B82_1, G_B82_0, L_212, /*hidden argument*/NULL);
- intptr_t L_213 = ___L0;
- lua_CSFunction_t883524059 * L_214 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache29_41();
- G_B83_0 = _stringLiteral4197268947;
- G_B83_1 = ((int32_t)-3);
- G_B83_2 = L_213;
- if (L_214)
- {
- G_B84_0 = _stringLiteral4197268947;
- G_B84_1 = ((int32_t)-3);
- G_B84_2 = L_213;
- goto IL_0701;
- }
- }
- {
- intptr_t L_215 = (intptr_t)UnityEngineTransformWrap__m_DOShakePosition_m3720856662_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_216 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_216, NULL, L_215, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache29_41(L_216);
- G_B84_0 = G_B83_0;
- G_B84_1 = G_B83_1;
- G_B84_2 = G_B83_2;
- }
- IL_0701:
- {
- lua_CSFunction_t883524059 * L_217 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache29_41();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B84_2, G_B84_1, G_B84_0, L_217, /*hidden argument*/NULL);
- intptr_t L_218 = ___L0;
- lua_CSFunction_t883524059 * L_219 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2A_42();
- G_B85_0 = _stringLiteral967657387;
- G_B85_1 = ((int32_t)-3);
- G_B85_2 = L_218;
- if (L_219)
- {
- G_B86_0 = _stringLiteral967657387;
- G_B86_1 = ((int32_t)-3);
- G_B86_2 = L_218;
- goto IL_072b;
- }
- }
- {
- intptr_t L_220 = (intptr_t)UnityEngineTransformWrap__m_DOShakeRotation_m241003690_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_221 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_221, NULL, L_220, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2A_42(L_221);
- G_B86_0 = G_B85_0;
- G_B86_1 = G_B85_1;
- G_B86_2 = G_B85_2;
- }
- IL_072b:
- {
- lua_CSFunction_t883524059 * L_222 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2A_42();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B86_2, G_B86_1, G_B86_0, L_222, /*hidden argument*/NULL);
- intptr_t L_223 = ___L0;
- lua_CSFunction_t883524059 * L_224 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2B_43();
- G_B87_0 = _stringLiteral1601687253;
- G_B87_1 = ((int32_t)-3);
- G_B87_2 = L_223;
- if (L_224)
- {
- G_B88_0 = _stringLiteral1601687253;
- G_B88_1 = ((int32_t)-3);
- G_B88_2 = L_223;
- goto IL_0755;
- }
- }
- {
- intptr_t L_225 = (intptr_t)UnityEngineTransformWrap__m_DOShakeScale_m2406116869_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_226 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_226, NULL, L_225, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2B_43(L_226);
- G_B88_0 = G_B87_0;
- G_B88_1 = G_B87_1;
- G_B88_2 = G_B87_2;
- }
- IL_0755:
- {
- lua_CSFunction_t883524059 * L_227 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2B_43();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B88_2, G_B88_1, G_B88_0, L_227, /*hidden argument*/NULL);
- intptr_t L_228 = ___L0;
- lua_CSFunction_t883524059 * L_229 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2C_44();
- G_B89_0 = _stringLiteral972089301;
- G_B89_1 = ((int32_t)-3);
- G_B89_2 = L_228;
- if (L_229)
- {
- G_B90_0 = _stringLiteral972089301;
- G_B90_1 = ((int32_t)-3);
- G_B90_2 = L_228;
- goto IL_077f;
- }
- }
- {
- intptr_t L_230 = (intptr_t)UnityEngineTransformWrap__m_DOJump_m4133327798_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_231 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_231, NULL, L_230, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2C_44(L_231);
- G_B90_0 = G_B89_0;
- G_B90_1 = G_B89_1;
- G_B90_2 = G_B89_2;
- }
- IL_077f:
- {
- lua_CSFunction_t883524059 * L_232 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2C_44();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B90_2, G_B90_1, G_B90_0, L_232, /*hidden argument*/NULL);
- intptr_t L_233 = ___L0;
- lua_CSFunction_t883524059 * L_234 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2D_45();
- G_B91_0 = _stringLiteral2564458223;
- G_B91_1 = ((int32_t)-3);
- G_B91_2 = L_233;
- if (L_234)
- {
- G_B92_0 = _stringLiteral2564458223;
- G_B92_1 = ((int32_t)-3);
- G_B92_2 = L_233;
- goto IL_07a9;
- }
- }
- {
- intptr_t L_235 = (intptr_t)UnityEngineTransformWrap__m_DOLocalJump_m296616187_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_236 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_236, NULL, L_235, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2D_45(L_236);
- G_B92_0 = G_B91_0;
- G_B92_1 = G_B91_1;
- G_B92_2 = G_B91_2;
- }
- IL_07a9:
- {
- lua_CSFunction_t883524059 * L_237 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2D_45();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B92_2, G_B92_1, G_B92_0, L_237, /*hidden argument*/NULL);
- intptr_t L_238 = ___L0;
- lua_CSFunction_t883524059 * L_239 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2E_46();
- G_B93_0 = _stringLiteral1454528960;
- G_B93_1 = ((int32_t)-3);
- G_B93_2 = L_238;
- if (L_239)
- {
- G_B94_0 = _stringLiteral1454528960;
- G_B94_1 = ((int32_t)-3);
- G_B94_2 = L_238;
- goto IL_07d3;
- }
- }
- {
- intptr_t L_240 = (intptr_t)UnityEngineTransformWrap__m_DOPath_m2509685622_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_241 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_241, NULL, L_240, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2E_46(L_241);
- G_B94_0 = G_B93_0;
- G_B94_1 = G_B93_1;
- G_B94_2 = G_B93_2;
- }
- IL_07d3:
- {
- lua_CSFunction_t883524059 * L_242 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2E_46();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B94_2, G_B94_1, G_B94_0, L_242, /*hidden argument*/NULL);
- intptr_t L_243 = ___L0;
- lua_CSFunction_t883524059 * L_244 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2F_47();
- G_B95_0 = _stringLiteral3013075459;
- G_B95_1 = ((int32_t)-3);
- G_B95_2 = L_243;
- if (L_244)
- {
- G_B96_0 = _stringLiteral3013075459;
- G_B96_1 = ((int32_t)-3);
- G_B96_2 = L_243;
- goto IL_07fd;
- }
- }
- {
- intptr_t L_245 = (intptr_t)UnityEngineTransformWrap__m_DOLocalPath_m442715724_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_246 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_246, NULL, L_245, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2F_47(L_246);
- G_B96_0 = G_B95_0;
- G_B96_1 = G_B95_1;
- G_B96_2 = G_B95_2;
- }
- IL_07fd:
- {
- lua_CSFunction_t883524059 * L_247 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2F_47();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B96_2, G_B96_1, G_B96_0, L_247, /*hidden argument*/NULL);
- intptr_t L_248 = ___L0;
- lua_CSFunction_t883524059 * L_249 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache30_48();
- G_B97_0 = _stringLiteral2729111217;
- G_B97_1 = ((int32_t)-3);
- G_B97_2 = L_248;
- if (L_249)
- {
- G_B98_0 = _stringLiteral2729111217;
- G_B98_1 = ((int32_t)-3);
- G_B98_2 = L_248;
- goto IL_0827;
- }
- }
- {
- intptr_t L_250 = (intptr_t)UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_251 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_251, NULL, L_250, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache30_48(L_251);
- G_B98_0 = G_B97_0;
- G_B98_1 = G_B97_1;
- G_B98_2 = G_B97_2;
- }
- IL_0827:
- {
- lua_CSFunction_t883524059 * L_252 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache30_48();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B98_2, G_B98_1, G_B98_0, L_252, /*hidden argument*/NULL);
- intptr_t L_253 = ___L0;
- lua_CSFunction_t883524059 * L_254 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache31_49();
- G_B99_0 = _stringLiteral3822669038;
- G_B99_1 = ((int32_t)-3);
- G_B99_2 = L_253;
- if (L_254)
- {
- G_B100_0 = _stringLiteral3822669038;
- G_B100_1 = ((int32_t)-3);
- G_B100_2 = L_253;
- goto IL_0851;
- }
- }
- {
- intptr_t L_255 = (intptr_t)UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_256 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_256, NULL, L_255, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache31_49(L_256);
- G_B100_0 = G_B99_0;
- G_B100_1 = G_B99_1;
- G_B100_2 = G_B99_2;
- }
- IL_0851:
- {
- lua_CSFunction_t883524059 * L_257 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache31_49();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B100_2, G_B100_1, G_B100_0, L_257, /*hidden argument*/NULL);
- intptr_t L_258 = ___L0;
- lua_CSFunction_t883524059 * L_259 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache32_50();
- G_B101_0 = _stringLiteral2921184537;
- G_B101_1 = ((int32_t)-3);
- G_B101_2 = L_258;
- if (L_259)
- {
- G_B102_0 = _stringLiteral2921184537;
- G_B102_1 = ((int32_t)-3);
- G_B102_2 = L_258;
- goto IL_087b;
- }
- }
- {
- intptr_t L_260 = (intptr_t)UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_261 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_261, NULL, L_260, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache32_50(L_261);
- G_B102_0 = G_B101_0;
- G_B102_1 = G_B101_1;
- G_B102_2 = G_B101_2;
- }
- IL_087b:
- {
- lua_CSFunction_t883524059 * L_262 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache32_50();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B102_2, G_B102_1, G_B102_0, L_262, /*hidden argument*/NULL);
- intptr_t L_263 = ___L0;
- lua_CSFunction_t883524059 * L_264 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache33_51();
- G_B103_0 = _stringLiteral3024622086;
- G_B103_1 = ((int32_t)-3);
- G_B103_2 = L_263;
- if (L_264)
- {
- G_B104_0 = _stringLiteral3024622086;
- G_B104_1 = ((int32_t)-3);
- G_B104_2 = L_263;
- goto IL_08a5;
- }
- }
- {
- intptr_t L_265 = (intptr_t)UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_266 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_266, NULL, L_265, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache33_51(L_266);
- G_B104_0 = G_B103_0;
- G_B104_1 = G_B103_1;
- G_B104_2 = G_B103_2;
- }
- IL_08a5:
- {
- lua_CSFunction_t883524059 * L_267 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache33_51();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B104_2, G_B104_1, G_B104_0, L_267, /*hidden argument*/NULL);
- intptr_t L_268 = ___L0;
- lua_CSFunction_t883524059 * L_269 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache34_52();
- G_B105_0 = _stringLiteral630218565;
- G_B105_1 = ((int32_t)-3);
- G_B105_2 = L_268;
- if (L_269)
- {
- G_B106_0 = _stringLiteral630218565;
- G_B106_1 = ((int32_t)-3);
- G_B106_2 = L_268;
- goto IL_08cf;
- }
- }
- {
- intptr_t L_270 = (intptr_t)UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_271 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_271, NULL, L_270, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache34_52(L_271);
- G_B106_0 = G_B105_0;
- G_B106_1 = G_B105_1;
- G_B106_2 = G_B105_2;
- }
- IL_08cf:
- {
- lua_CSFunction_t883524059 * L_272 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache34_52();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B106_2, G_B106_1, G_B106_0, L_272, /*hidden argument*/NULL);
- intptr_t L_273 = ___L0;
- lua_CSFunction_t883524059 * L_274 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache35_53();
- G_B107_0 = _stringLiteral2406798247;
- G_B107_1 = ((int32_t)-3);
- G_B107_2 = L_273;
- if (L_274)
- {
- G_B108_0 = _stringLiteral2406798247;
- G_B108_1 = ((int32_t)-3);
- G_B108_2 = L_273;
- goto IL_08f9;
- }
- }
- {
- intptr_t L_275 = (intptr_t)UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_276 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_276, NULL, L_275, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache35_53(L_276);
- G_B108_0 = G_B107_0;
- G_B108_1 = G_B107_1;
- G_B108_2 = G_B107_2;
- }
- IL_08f9:
- {
- lua_CSFunction_t883524059 * L_277 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache35_53();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B108_2, G_B108_1, G_B108_0, L_277, /*hidden argument*/NULL);
- intptr_t L_278 = ___L0;
- lua_CSFunction_t883524059 * L_279 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache36_54();
- G_B109_0 = _stringLiteral4254451314;
- G_B109_1 = ((int32_t)-2);
- G_B109_2 = L_278;
- if (L_279)
- {
- G_B110_0 = _stringLiteral4254451314;
- G_B110_1 = ((int32_t)-2);
- G_B110_2 = L_278;
- goto IL_0923;
- }
- }
- {
- intptr_t L_280 = (intptr_t)UnityEngineTransformWrap__g_get_position_m2180048924_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_281 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_281, NULL, L_280, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache36_54(L_281);
- G_B110_0 = G_B109_0;
- G_B110_1 = G_B109_1;
- G_B110_2 = G_B109_2;
- }
- IL_0923:
- {
- lua_CSFunction_t883524059 * L_282 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache36_54();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B110_2, G_B110_1, G_B110_0, L_282, /*hidden argument*/NULL);
- intptr_t L_283 = ___L0;
- lua_CSFunction_t883524059 * L_284 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache37_55();
- G_B111_0 = _stringLiteral3699321548;
- G_B111_1 = ((int32_t)-2);
- G_B111_2 = L_283;
- if (L_284)
- {
- G_B112_0 = _stringLiteral3699321548;
- G_B112_1 = ((int32_t)-2);
- G_B112_2 = L_283;
- goto IL_094d;
- }
- }
- {
- intptr_t L_285 = (intptr_t)UnityEngineTransformWrap__g_get_localPosition_m3878105019_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_286 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_286, NULL, L_285, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache37_55(L_286);
- G_B112_0 = G_B111_0;
- G_B112_1 = G_B111_1;
- G_B112_2 = G_B111_2;
- }
- IL_094d:
- {
- lua_CSFunction_t883524059 * L_287 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache37_55();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B112_2, G_B112_1, G_B112_0, L_287, /*hidden argument*/NULL);
- intptr_t L_288 = ___L0;
- lua_CSFunction_t883524059 * L_289 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache38_56();
- G_B113_0 = _stringLiteral3956817887;
- G_B113_1 = ((int32_t)-2);
- G_B113_2 = L_288;
- if (L_289)
- {
- G_B114_0 = _stringLiteral3956817887;
- G_B114_1 = ((int32_t)-2);
- G_B114_2 = L_288;
- goto IL_0977;
- }
- }
- {
- intptr_t L_290 = (intptr_t)UnityEngineTransformWrap__g_get_eulerAngles_m3922999519_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_291 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_291, NULL, L_290, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache38_56(L_291);
- G_B114_0 = G_B113_0;
- G_B114_1 = G_B113_1;
- G_B114_2 = G_B113_2;
- }
- IL_0977:
- {
- lua_CSFunction_t883524059 * L_292 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache38_56();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B114_2, G_B114_1, G_B114_0, L_292, /*hidden argument*/NULL);
- intptr_t L_293 = ___L0;
- lua_CSFunction_t883524059 * L_294 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache39_57();
- G_B115_0 = _stringLiteral3332460623;
- G_B115_1 = ((int32_t)-2);
- G_B115_2 = L_293;
- if (L_294)
- {
- G_B116_0 = _stringLiteral3332460623;
- G_B116_1 = ((int32_t)-2);
- G_B116_2 = L_293;
- goto IL_09a1;
- }
- }
- {
- intptr_t L_295 = (intptr_t)UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_296 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_296, NULL, L_295, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache39_57(L_296);
- G_B116_0 = G_B115_0;
- G_B116_1 = G_B115_1;
- G_B116_2 = G_B115_2;
- }
- IL_09a1:
- {
- lua_CSFunction_t883524059 * L_297 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache39_57();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B116_2, G_B116_1, G_B116_0, L_297, /*hidden argument*/NULL);
- intptr_t L_298 = ___L0;
- lua_CSFunction_t883524059 * L_299 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3A_58();
- G_B117_0 = _stringLiteral742876383;
- G_B117_1 = ((int32_t)-2);
- G_B117_2 = L_298;
- if (L_299)
- {
- G_B118_0 = _stringLiteral742876383;
- G_B118_1 = ((int32_t)-2);
- G_B118_2 = L_298;
- goto IL_09cb;
- }
- }
- {
- intptr_t L_300 = (intptr_t)UnityEngineTransformWrap__g_get_right_m469775628_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_301 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_301, NULL, L_300, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3A_58(L_301);
- G_B118_0 = G_B117_0;
- G_B118_1 = G_B117_1;
- G_B118_2 = G_B117_2;
- }
- IL_09cb:
- {
- lua_CSFunction_t883524059 * L_302 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3A_58();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B118_2, G_B118_1, G_B118_0, L_302, /*hidden argument*/NULL);
- intptr_t L_303 = ___L0;
- lua_CSFunction_t883524059 * L_304 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3B_59();
- G_B119_0 = _stringLiteral3455760331;
- G_B119_1 = ((int32_t)-2);
- G_B119_2 = L_303;
- if (L_304)
- {
- G_B120_0 = _stringLiteral3455760331;
- G_B120_1 = ((int32_t)-2);
- G_B120_2 = L_303;
- goto IL_09f5;
- }
- }
- {
- intptr_t L_305 = (intptr_t)UnityEngineTransformWrap__g_get_up_m3208095539_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_306 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_306, NULL, L_305, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3B_59(L_306);
- G_B120_0 = G_B119_0;
- G_B120_1 = G_B119_1;
- G_B120_2 = G_B119_2;
- }
- IL_09f5:
- {
- lua_CSFunction_t883524059 * L_307 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3B_59();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B120_2, G_B120_1, G_B120_0, L_307, /*hidden argument*/NULL);
- intptr_t L_308 = ___L0;
- lua_CSFunction_t883524059 * L_309 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3C_60();
- G_B121_0 = _stringLiteral922536097;
- G_B121_1 = ((int32_t)-2);
- G_B121_2 = L_308;
- if (L_309)
- {
- G_B122_0 = _stringLiteral922536097;
- G_B122_1 = ((int32_t)-2);
- G_B122_2 = L_308;
- goto IL_0a1f;
- }
- }
- {
- intptr_t L_310 = (intptr_t)UnityEngineTransformWrap__g_get_forward_m2765842083_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_311 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_311, NULL, L_310, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3C_60(L_311);
- G_B122_0 = G_B121_0;
- G_B122_1 = G_B121_1;
- G_B122_2 = G_B121_2;
- }
- IL_0a1f:
- {
- lua_CSFunction_t883524059 * L_312 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3C_60();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B122_2, G_B122_1, G_B122_0, L_312, /*hidden argument*/NULL);
- intptr_t L_313 = ___L0;
- lua_CSFunction_t883524059 * L_314 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3D_61();
- G_B123_0 = _stringLiteral1757920701;
- G_B123_1 = ((int32_t)-2);
- G_B123_2 = L_313;
- if (L_314)
- {
- G_B124_0 = _stringLiteral1757920701;
- G_B124_1 = ((int32_t)-2);
- G_B124_2 = L_313;
- goto IL_0a49;
- }
- }
- {
- intptr_t L_315 = (intptr_t)UnityEngineTransformWrap__g_get_rotation_m1745653753_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_316 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_316, NULL, L_315, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3D_61(L_316);
- G_B124_0 = G_B123_0;
- G_B124_1 = G_B123_1;
- G_B124_2 = G_B123_2;
- }
- IL_0a49:
- {
- lua_CSFunction_t883524059 * L_317 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3D_61();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B124_2, G_B124_1, G_B124_0, L_317, /*hidden argument*/NULL);
- intptr_t L_318 = ___L0;
- lua_CSFunction_t883524059 * L_319 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3E_62();
- G_B125_0 = _stringLiteral1486761124;
- G_B125_1 = ((int32_t)-2);
- G_B125_2 = L_318;
- if (L_319)
- {
- G_B126_0 = _stringLiteral1486761124;
- G_B126_1 = ((int32_t)-2);
- G_B126_2 = L_318;
- goto IL_0a73;
- }
- }
- {
- intptr_t L_320 = (intptr_t)UnityEngineTransformWrap__g_get_localRotation_m637984894_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_321 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_321, NULL, L_320, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3E_62(L_321);
- G_B126_0 = G_B125_0;
- G_B126_1 = G_B125_1;
- G_B126_2 = G_B125_2;
- }
- IL_0a73:
- {
- lua_CSFunction_t883524059 * L_322 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3E_62();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B126_2, G_B126_1, G_B126_0, L_322, /*hidden argument*/NULL);
- intptr_t L_323 = ___L0;
- lua_CSFunction_t883524059 * L_324 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3F_63();
- G_B127_0 = _stringLiteral1570321587;
- G_B127_1 = ((int32_t)-2);
- G_B127_2 = L_323;
- if (L_324)
- {
- G_B128_0 = _stringLiteral1570321587;
- G_B128_1 = ((int32_t)-2);
- G_B128_2 = L_323;
- goto IL_0a9d;
- }
- }
- {
- intptr_t L_325 = (intptr_t)UnityEngineTransformWrap__g_get_localScale_m3915212871_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_326 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_326, NULL, L_325, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3F_63(L_326);
- G_B128_0 = G_B127_0;
- G_B128_1 = G_B127_1;
- G_B128_2 = G_B127_2;
- }
- IL_0a9d:
- {
- lua_CSFunction_t883524059 * L_327 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3F_63();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B128_2, G_B128_1, G_B128_0, L_327, /*hidden argument*/NULL);
- intptr_t L_328 = ___L0;
- lua_CSFunction_t883524059 * L_329 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache40_64();
- G_B129_0 = _stringLiteral3215840460;
- G_B129_1 = ((int32_t)-2);
- G_B129_2 = L_328;
- if (L_329)
- {
- G_B130_0 = _stringLiteral3215840460;
- G_B130_1 = ((int32_t)-2);
- G_B130_2 = L_328;
- goto IL_0ac7;
- }
- }
- {
- intptr_t L_330 = (intptr_t)UnityEngineTransformWrap__g_get_parent_m3003513812_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_331 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_331, NULL, L_330, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache40_64(L_331);
- G_B130_0 = G_B129_0;
- G_B130_1 = G_B129_1;
- G_B130_2 = G_B129_2;
- }
- IL_0ac7:
- {
- lua_CSFunction_t883524059 * L_332 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache40_64();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B130_2, G_B130_1, G_B130_0, L_332, /*hidden argument*/NULL);
- intptr_t L_333 = ___L0;
- lua_CSFunction_t883524059 * L_334 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache41_65();
- G_B131_0 = _stringLiteral3135612287;
- G_B131_1 = ((int32_t)-2);
- G_B131_2 = L_333;
- if (L_334)
- {
- G_B132_0 = _stringLiteral3135612287;
- G_B132_1 = ((int32_t)-2);
- G_B132_2 = L_333;
- goto IL_0af1;
- }
- }
- {
- intptr_t L_335 = (intptr_t)UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_336 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_336, NULL, L_335, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache41_65(L_336);
- G_B132_0 = G_B131_0;
- G_B132_1 = G_B131_1;
- G_B132_2 = G_B131_2;
- }
- IL_0af1:
- {
- lua_CSFunction_t883524059 * L_337 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache41_65();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B132_2, G_B132_1, G_B132_0, L_337, /*hidden argument*/NULL);
- intptr_t L_338 = ___L0;
- lua_CSFunction_t883524059 * L_339 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache42_66();
- G_B133_0 = _stringLiteral2446588013;
- G_B133_1 = ((int32_t)-2);
- G_B133_2 = L_338;
- if (L_339)
- {
- G_B134_0 = _stringLiteral2446588013;
- G_B134_1 = ((int32_t)-2);
- G_B134_2 = L_338;
- goto IL_0b1b;
- }
- }
- {
- intptr_t L_340 = (intptr_t)UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_341 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_341, NULL, L_340, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache42_66(L_341);
- G_B134_0 = G_B133_0;
- G_B134_1 = G_B133_1;
- G_B134_2 = G_B133_2;
- }
- IL_0b1b:
- {
- lua_CSFunction_t883524059 * L_342 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache42_66();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B134_2, G_B134_1, G_B134_0, L_342, /*hidden argument*/NULL);
- intptr_t L_343 = ___L0;
- lua_CSFunction_t883524059 * L_344 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache43_67();
- G_B135_0 = _stringLiteral2328036797;
- G_B135_1 = ((int32_t)-2);
- G_B135_2 = L_343;
- if (L_344)
- {
- G_B136_0 = _stringLiteral2328036797;
- G_B136_1 = ((int32_t)-2);
- G_B136_2 = L_343;
- goto IL_0b45;
- }
- }
- {
- intptr_t L_345 = (intptr_t)UnityEngineTransformWrap__g_get_root_m58896500_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_346 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_346, NULL, L_345, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache43_67(L_346);
- G_B136_0 = G_B135_0;
- G_B136_1 = G_B135_1;
- G_B136_2 = G_B135_2;
- }
- IL_0b45:
- {
- lua_CSFunction_t883524059 * L_347 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache43_67();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B136_2, G_B136_1, G_B136_0, L_347, /*hidden argument*/NULL);
- intptr_t L_348 = ___L0;
- lua_CSFunction_t883524059 * L_349 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache44_68();
- G_B137_0 = _stringLiteral850590460;
- G_B137_1 = ((int32_t)-2);
- G_B137_2 = L_348;
- if (L_349)
- {
- G_B138_0 = _stringLiteral850590460;
- G_B138_1 = ((int32_t)-2);
- G_B138_2 = L_348;
- goto IL_0b6f;
- }
- }
- {
- intptr_t L_350 = (intptr_t)UnityEngineTransformWrap__g_get_childCount_m222537369_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_351 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_351, NULL, L_350, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache44_68(L_351);
- G_B138_0 = G_B137_0;
- G_B138_1 = G_B137_1;
- G_B138_2 = G_B137_2;
- }
- IL_0b6f:
- {
- lua_CSFunction_t883524059 * L_352 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache44_68();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B138_2, G_B138_1, G_B138_0, L_352, /*hidden argument*/NULL);
- intptr_t L_353 = ___L0;
- lua_CSFunction_t883524059 * L_354 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache45_69();
- G_B139_0 = _stringLiteral2459688246;
- G_B139_1 = ((int32_t)-2);
- G_B139_2 = L_353;
- if (L_354)
- {
- G_B140_0 = _stringLiteral2459688246;
- G_B140_1 = ((int32_t)-2);
- G_B140_2 = L_353;
- goto IL_0b99;
- }
- }
- {
- intptr_t L_355 = (intptr_t)UnityEngineTransformWrap__g_get_lossyScale_m3129807950_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_356 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_356, NULL, L_355, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache45_69(L_356);
- G_B140_0 = G_B139_0;
- G_B140_1 = G_B139_1;
- G_B140_2 = G_B139_2;
- }
- IL_0b99:
- {
- lua_CSFunction_t883524059 * L_357 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache45_69();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B140_2, G_B140_1, G_B140_0, L_357, /*hidden argument*/NULL);
- intptr_t L_358 = ___L0;
- lua_CSFunction_t883524059 * L_359 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache46_70();
- G_B141_0 = _stringLiteral1701458771;
- G_B141_1 = ((int32_t)-2);
- G_B141_2 = L_358;
- if (L_359)
- {
- G_B142_0 = _stringLiteral1701458771;
- G_B142_1 = ((int32_t)-2);
- G_B142_2 = L_358;
- goto IL_0bc3;
- }
- }
- {
- intptr_t L_360 = (intptr_t)UnityEngineTransformWrap__g_get_hasChanged_m2133940418_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_361 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_361, NULL, L_360, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache46_70(L_361);
- G_B142_0 = G_B141_0;
- G_B142_1 = G_B141_1;
- G_B142_2 = G_B141_2;
- }
- IL_0bc3:
- {
- lua_CSFunction_t883524059 * L_362 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache46_70();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B142_2, G_B142_1, G_B142_0, L_362, /*hidden argument*/NULL);
- intptr_t L_363 = ___L0;
- lua_CSFunction_t883524059 * L_364 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache47_71();
- G_B143_0 = _stringLiteral2534080674;
- G_B143_1 = ((int32_t)-2);
- G_B143_2 = L_363;
- if (L_364)
- {
- G_B144_0 = _stringLiteral2534080674;
- G_B144_1 = ((int32_t)-2);
- G_B144_2 = L_363;
- goto IL_0bed;
- }
- }
- {
- intptr_t L_365 = (intptr_t)UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_366 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_366, NULL, L_365, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache47_71(L_366);
- G_B144_0 = G_B143_0;
- G_B144_1 = G_B143_1;
- G_B144_2 = G_B143_2;
- }
- IL_0bed:
- {
- lua_CSFunction_t883524059 * L_367 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache47_71();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B144_2, G_B144_1, G_B144_0, L_367, /*hidden argument*/NULL);
- intptr_t L_368 = ___L0;
- lua_CSFunction_t883524059 * L_369 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache48_72();
- G_B145_0 = _stringLiteral3341417625;
- G_B145_1 = ((int32_t)-2);
- G_B145_2 = L_368;
- if (L_369)
- {
- G_B146_0 = _stringLiteral3341417625;
- G_B146_1 = ((int32_t)-2);
- G_B146_2 = L_368;
- goto IL_0c17;
- }
- }
- {
- intptr_t L_370 = (intptr_t)UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_371 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_371, NULL, L_370, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache48_72(L_371);
- G_B146_0 = G_B145_0;
- G_B146_1 = G_B145_1;
- G_B146_2 = G_B145_2;
- }
- IL_0c17:
- {
- lua_CSFunction_t883524059 * L_372 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache48_72();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B146_2, G_B146_1, G_B146_0, L_372, /*hidden argument*/NULL);
- intptr_t L_373 = ___L0;
- lua_CSFunction_t883524059 * L_374 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache49_73();
- G_B147_0 = _stringLiteral4254451314;
- G_B147_1 = (-1);
- G_B147_2 = L_373;
- if (L_374)
- {
- G_B148_0 = _stringLiteral4254451314;
- G_B148_1 = (-1);
- G_B148_2 = L_373;
- goto IL_0c40;
- }
- }
- {
- intptr_t L_375 = (intptr_t)UnityEngineTransformWrap__s_set_position_m2248180735_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_376 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_376, NULL, L_375, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache49_73(L_376);
- G_B148_0 = G_B147_0;
- G_B148_1 = G_B147_1;
- G_B148_2 = G_B147_2;
- }
- IL_0c40:
- {
- lua_CSFunction_t883524059 * L_377 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache49_73();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B148_2, G_B148_1, G_B148_0, L_377, /*hidden argument*/NULL);
- intptr_t L_378 = ___L0;
- lua_CSFunction_t883524059 * L_379 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4A_74();
- G_B149_0 = _stringLiteral3699321548;
- G_B149_1 = (-1);
- G_B149_2 = L_378;
- if (L_379)
- {
- G_B150_0 = _stringLiteral3699321548;
- G_B150_1 = (-1);
- G_B150_2 = L_378;
- goto IL_0c69;
- }
- }
- {
- intptr_t L_380 = (intptr_t)UnityEngineTransformWrap__s_set_localPosition_m572438127_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_381 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_381, NULL, L_380, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4A_74(L_381);
- G_B150_0 = G_B149_0;
- G_B150_1 = G_B149_1;
- G_B150_2 = G_B149_2;
- }
- IL_0c69:
- {
- lua_CSFunction_t883524059 * L_382 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4A_74();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B150_2, G_B150_1, G_B150_0, L_382, /*hidden argument*/NULL);
- intptr_t L_383 = ___L0;
- lua_CSFunction_t883524059 * L_384 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4B_75();
- G_B151_0 = _stringLiteral3956817887;
- G_B151_1 = (-1);
- G_B151_2 = L_383;
- if (L_384)
- {
- G_B152_0 = _stringLiteral3956817887;
- G_B152_1 = (-1);
- G_B152_2 = L_383;
- goto IL_0c92;
- }
- }
- {
- intptr_t L_385 = (intptr_t)UnityEngineTransformWrap__s_set_eulerAngles_m2405101980_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_386 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_386, NULL, L_385, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4B_75(L_386);
- G_B152_0 = G_B151_0;
- G_B152_1 = G_B151_1;
- G_B152_2 = G_B151_2;
- }
- IL_0c92:
- {
- lua_CSFunction_t883524059 * L_387 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4B_75();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B152_2, G_B152_1, G_B152_0, L_387, /*hidden argument*/NULL);
- intptr_t L_388 = ___L0;
- lua_CSFunction_t883524059 * L_389 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4C_76();
- G_B153_0 = _stringLiteral3332460623;
- G_B153_1 = (-1);
- G_B153_2 = L_388;
- if (L_389)
- {
- G_B154_0 = _stringLiteral3332460623;
- G_B154_1 = (-1);
- G_B154_2 = L_388;
- goto IL_0cbb;
- }
- }
- {
- intptr_t L_390 = (intptr_t)UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_391 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_391, NULL, L_390, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4C_76(L_391);
- G_B154_0 = G_B153_0;
- G_B154_1 = G_B153_1;
- G_B154_2 = G_B153_2;
- }
- IL_0cbb:
- {
- lua_CSFunction_t883524059 * L_392 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4C_76();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B154_2, G_B154_1, G_B154_0, L_392, /*hidden argument*/NULL);
- intptr_t L_393 = ___L0;
- lua_CSFunction_t883524059 * L_394 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4D_77();
- G_B155_0 = _stringLiteral742876383;
- G_B155_1 = (-1);
- G_B155_2 = L_393;
- if (L_394)
- {
- G_B156_0 = _stringLiteral742876383;
- G_B156_1 = (-1);
- G_B156_2 = L_393;
- goto IL_0ce4;
- }
- }
- {
- intptr_t L_395 = (intptr_t)UnityEngineTransformWrap__s_set_right_m1502050898_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_396 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_396, NULL, L_395, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4D_77(L_396);
- G_B156_0 = G_B155_0;
- G_B156_1 = G_B155_1;
- G_B156_2 = G_B155_2;
- }
- IL_0ce4:
- {
- lua_CSFunction_t883524059 * L_397 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4D_77();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B156_2, G_B156_1, G_B156_0, L_397, /*hidden argument*/NULL);
- intptr_t L_398 = ___L0;
- lua_CSFunction_t883524059 * L_399 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4E_78();
- G_B157_0 = _stringLiteral3455760331;
- G_B157_1 = (-1);
- G_B157_2 = L_398;
- if (L_399)
- {
- G_B158_0 = _stringLiteral3455760331;
- G_B158_1 = (-1);
- G_B158_2 = L_398;
- goto IL_0d0d;
- }
- }
- {
- intptr_t L_400 = (intptr_t)UnityEngineTransformWrap__s_set_up_m1616193993_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_401 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_401, NULL, L_400, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4E_78(L_401);
- G_B158_0 = G_B157_0;
- G_B158_1 = G_B157_1;
- G_B158_2 = G_B157_2;
- }
- IL_0d0d:
- {
- lua_CSFunction_t883524059 * L_402 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4E_78();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B158_2, G_B158_1, G_B158_0, L_402, /*hidden argument*/NULL);
- intptr_t L_403 = ___L0;
- lua_CSFunction_t883524059 * L_404 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4F_79();
- G_B159_0 = _stringLiteral922536097;
- G_B159_1 = (-1);
- G_B159_2 = L_403;
- if (L_404)
- {
- G_B160_0 = _stringLiteral922536097;
- G_B160_1 = (-1);
- G_B160_2 = L_403;
- goto IL_0d36;
- }
- }
- {
- intptr_t L_405 = (intptr_t)UnityEngineTransformWrap__s_set_forward_m1425629139_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_406 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_406, NULL, L_405, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4F_79(L_406);
- G_B160_0 = G_B159_0;
- G_B160_1 = G_B159_1;
- G_B160_2 = G_B159_2;
- }
- IL_0d36:
- {
- lua_CSFunction_t883524059 * L_407 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4F_79();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B160_2, G_B160_1, G_B160_0, L_407, /*hidden argument*/NULL);
- intptr_t L_408 = ___L0;
- lua_CSFunction_t883524059 * L_409 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache50_80();
- G_B161_0 = _stringLiteral1757920701;
- G_B161_1 = (-1);
- G_B161_2 = L_408;
- if (L_409)
- {
- G_B162_0 = _stringLiteral1757920701;
- G_B162_1 = (-1);
- G_B162_2 = L_408;
- goto IL_0d5f;
- }
- }
- {
- intptr_t L_410 = (intptr_t)UnityEngineTransformWrap__s_set_rotation_m2344385924_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_411 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_411, NULL, L_410, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache50_80(L_411);
- G_B162_0 = G_B161_0;
- G_B162_1 = G_B161_1;
- G_B162_2 = G_B161_2;
- }
- IL_0d5f:
- {
- lua_CSFunction_t883524059 * L_412 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache50_80();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B162_2, G_B162_1, G_B162_0, L_412, /*hidden argument*/NULL);
- intptr_t L_413 = ___L0;
- lua_CSFunction_t883524059 * L_414 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache51_81();
- G_B163_0 = _stringLiteral1486761124;
- G_B163_1 = (-1);
- G_B163_2 = L_413;
- if (L_414)
- {
- G_B164_0 = _stringLiteral1486761124;
- G_B164_1 = (-1);
- G_B164_2 = L_413;
- goto IL_0d88;
- }
- }
- {
- intptr_t L_415 = (intptr_t)UnityEngineTransformWrap__s_set_localRotation_m3029152408_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_416 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_416, NULL, L_415, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache51_81(L_416);
- G_B164_0 = G_B163_0;
- G_B164_1 = G_B163_1;
- G_B164_2 = G_B163_2;
- }
- IL_0d88:
- {
- lua_CSFunction_t883524059 * L_417 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache51_81();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B164_2, G_B164_1, G_B164_0, L_417, /*hidden argument*/NULL);
- intptr_t L_418 = ___L0;
- lua_CSFunction_t883524059 * L_419 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache52_82();
- G_B165_0 = _stringLiteral1570321587;
- G_B165_1 = (-1);
- G_B165_2 = L_418;
- if (L_419)
- {
- G_B166_0 = _stringLiteral1570321587;
- G_B166_1 = (-1);
- G_B166_2 = L_418;
- goto IL_0db1;
- }
- }
- {
- intptr_t L_420 = (intptr_t)UnityEngineTransformWrap__s_set_localScale_m1212933853_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_421 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_421, NULL, L_420, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache52_82(L_421);
- G_B166_0 = G_B165_0;
- G_B166_1 = G_B165_1;
- G_B166_2 = G_B165_2;
- }
- IL_0db1:
- {
- lua_CSFunction_t883524059 * L_422 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache52_82();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B166_2, G_B166_1, G_B166_0, L_422, /*hidden argument*/NULL);
- intptr_t L_423 = ___L0;
- lua_CSFunction_t883524059 * L_424 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache53_83();
- G_B167_0 = _stringLiteral3215840460;
- G_B167_1 = (-1);
- G_B167_2 = L_423;
- if (L_424)
- {
- G_B168_0 = _stringLiteral3215840460;
- G_B168_1 = (-1);
- G_B168_2 = L_423;
- goto IL_0dda;
- }
- }
- {
- intptr_t L_425 = (intptr_t)UnityEngineTransformWrap__s_set_parent_m3451686420_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_426 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_426, NULL, L_425, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache53_83(L_426);
- G_B168_0 = G_B167_0;
- G_B168_1 = G_B167_1;
- G_B168_2 = G_B167_2;
- }
- IL_0dda:
- {
- lua_CSFunction_t883524059 * L_427 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache53_83();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B168_2, G_B168_1, G_B168_0, L_427, /*hidden argument*/NULL);
- intptr_t L_428 = ___L0;
- lua_CSFunction_t883524059 * L_429 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache54_84();
- G_B169_0 = _stringLiteral1701458771;
- G_B169_1 = (-1);
- G_B169_2 = L_428;
- if (L_429)
- {
- G_B170_0 = _stringLiteral1701458771;
- G_B170_1 = (-1);
- G_B170_2 = L_428;
- goto IL_0e03;
- }
- }
- {
- intptr_t L_430 = (intptr_t)UnityEngineTransformWrap__s_set_hasChanged_m195551608_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_431 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_431, NULL, L_430, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache54_84(L_431);
- G_B170_0 = G_B169_0;
- G_B170_1 = G_B169_1;
- G_B170_2 = G_B169_2;
- }
- IL_0e03:
- {
- lua_CSFunction_t883524059 * L_432 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache54_84();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B170_2, G_B170_1, G_B170_0, L_432, /*hidden argument*/NULL);
- intptr_t L_433 = ___L0;
- lua_CSFunction_t883524059 * L_434 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache55_85();
- G_B171_0 = _stringLiteral2534080674;
- G_B171_1 = (-1);
- G_B171_2 = L_433;
- if (L_434)
- {
- G_B172_0 = _stringLiteral2534080674;
- G_B172_1 = (-1);
- G_B172_2 = L_433;
- goto IL_0e2c;
- }
- }
- {
- intptr_t L_435 = (intptr_t)UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_436 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_436, NULL, L_435, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache55_85(L_436);
- G_B172_0 = G_B171_0;
- G_B172_1 = G_B171_1;
- G_B172_2 = G_B171_2;
- }
- IL_0e2c:
- {
- lua_CSFunction_t883524059 * L_437 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache55_85();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B172_2, G_B172_1, G_B172_0, L_437, /*hidden argument*/NULL);
- Type_t * L_438 = V_1;
- intptr_t L_439 = ___L0;
- ObjectTranslator_t2020767555 * L_440 = V_0;
- Utils_EndObjectRegister_m3642684994(NULL /*static, unused*/, L_438, L_439, L_440, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, (Type_t *)NULL, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, /*hidden argument*/NULL);
- Type_t * L_441 = V_1;
- intptr_t L_442 = ___L0;
- lua_CSFunction_t883524059 * L_443 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache56_86();
- G_B173_0 = L_442;
- G_B173_1 = L_441;
- if (L_443)
- {
- G_B174_0 = L_442;
- G_B174_1 = L_441;
- goto IL_0e5d;
- }
- }
- {
- intptr_t L_444 = (intptr_t)UnityEngineTransformWrap___CreateInstance_m1894308163_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_445 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_445, NULL, L_444, /*hidden argument*/NULL);
- ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache56_86(L_445);
- G_B174_0 = G_B173_0;
- G_B174_1 = G_B173_1;
- }
- IL_0e5d:
- {
- lua_CSFunction_t883524059 * L_446 = ((UnityEngineTransformWrap_t3488644103_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineTransformWrap_t3488644103_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache56_86();
- Utils_BeginClassRegister_m3630094254(NULL /*static, unused*/, G_B174_1, G_B174_0, L_446, 1, 0, 0, /*hidden argument*/NULL);
- Type_t * L_447 = V_1;
- intptr_t L_448 = ___L0;
- ObjectTranslator_t2020767555 * L_449 = V_0;
- Utils_EndClassRegister_m1460189367(NULL /*static, unused*/, L_447, L_448, L_449, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap___CreateInstance_m1894308163 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap___CreateInstance_m1894308163_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- {
- intptr_t L_0 = ___L0;
- int32_t L_1 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_0, _stringLiteral2137581584, /*hidden argument*/NULL);
- return L_1;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetParent(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetParent_m804936730 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_SetParent_m804936730_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Transform_t3600365921 * V_3 = NULL;
- int32_t V_4 = 0;
- Transform_t3600365921 * V_5 = NULL;
- bool V_6 = false;
- Exception_t * V_7 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)2))))
- {
- goto IL_005c;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_005c;
- }
- }
- IL_0035:
- {
- ObjectTranslator_t2020767555 * L_12 = V_0;
- intptr_t L_13 = ___L0;
- RuntimeTypeHandle_t3027515415 L_14 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_15 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_14, /*hidden argument*/NULL);
- NullCheck(L_12);
- RuntimeObject * L_16 = ObjectTranslator_GetObject_m805173647(L_12, L_13, 2, L_15, /*hidden argument*/NULL);
- V_3 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_16, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_17 = V_1;
- Transform_t3600365921 * L_18 = V_3;
- NullCheck(L_17);
- Transform_SetParent_m381167889(L_17, L_18, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_00dd;
- }
- IL_005c:
- {
- int32_t L_19 = V_2;
- if ((!(((uint32_t)L_19) == ((uint32_t)3))))
- {
- goto IL_00b1;
- }
- }
- IL_0063:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- NullCheck(L_20);
- bool L_22 = ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(L_20, L_21, 2, /*hidden argument*/ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var);
- if (!L_22)
- {
- goto IL_00b1;
- }
- }
- IL_0070:
- {
- intptr_t L_23 = ___L0;
- int32_t L_24 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_23, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_24) == ((uint32_t)1))))
- {
- goto IL_00b1;
- }
- }
- IL_007d:
- {
- ObjectTranslator_t2020767555 * L_25 = V_0;
- intptr_t L_26 = ___L0;
- RuntimeTypeHandle_t3027515415 L_27 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_28 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_27, /*hidden argument*/NULL);
- NullCheck(L_25);
- RuntimeObject * L_29 = ObjectTranslator_GetObject_m805173647(L_25, L_26, 2, L_28, /*hidden argument*/NULL);
- V_5 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_29, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_30 = ___L0;
- bool L_31 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_30, 3, /*hidden argument*/NULL);
- V_6 = L_31;
- Transform_t3600365921 * L_32 = V_1;
- Transform_t3600365921 * L_33 = V_5;
- bool L_34 = V_6;
- NullCheck(L_32);
- Transform_SetParent_m273471670(L_32, L_33, L_34, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_00dd;
- }
- IL_00b1:
- {
- goto IL_00d1;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00b6;
- throw e;
- }
- CATCH_00b6:
- { // begin catch(System.Exception)
- V_7 = ((Exception_t *)__exception_local);
- intptr_t L_35 = ___L0;
- Exception_t * L_36 = V_7;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_37 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_36, /*hidden argument*/NULL);
- int32_t L_38 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_35, L_37, /*hidden argument*/NULL);
- V_4 = L_38;
- goto IL_00dd;
- } // end catch (depth: 1)
- IL_00d1:
- {
- intptr_t L_39 = ___L0;
- int32_t L_40 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_39, _stringLiteral2357750343, /*hidden argument*/NULL);
- return L_40;
- }
- IL_00dd:
- {
- int32_t L_41 = V_4;
- return L_41;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetPositionAndRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_SetPositionAndRotation_m220027778_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Quaternion_t2301928331 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- NullCheck(L_8);
- ObjectTranslator_Get_m3946340519(L_8, L_9, 3, (&V_3), /*hidden argument*/NULL);
- Transform_t3600365921 * L_10 = V_1;
- Vector3_t3722313464 L_11 = V_2;
- Quaternion_t2301928331 L_12 = V_3;
- NullCheck(L_10);
- Transform_SetPositionAndRotation_m2620258152(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_0059;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003e;
- throw e;
- }
- CATCH_003e:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0059;
- } // end catch (depth: 1)
- IL_0059:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_Translate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_Translate_m975680681 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_Translate_m975680681_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- int32_t V_6 = 0;
- Vector3_t3722313464 V_7;
- memset(&V_7, 0, sizeof(V_7));
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- float V_10 = 0.0f;
- int32_t V_11 = 0;
- float V_12 = 0.0f;
- float V_13 = 0.0f;
- float V_14 = 0.0f;
- Transform_t3600365921 * V_15 = NULL;
- Vector3_t3722313464 V_16;
- memset(&V_16, 0, sizeof(V_16));
- int32_t V_17 = 0;
- Vector3_t3722313464 V_18;
- memset(&V_18, 0, sizeof(V_18));
- Transform_t3600365921 * V_19 = NULL;
- Exception_t * V_20 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_007f;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_007f;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_007f;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_007f;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Transform_Translate_m3762500149(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0277;
- }
- IL_007f:
- {
- int32_t L_25 = V_2;
- if ((!(((uint32_t)L_25) == ((uint32_t)2))))
- {
- goto IL_00ad;
- }
- }
- IL_0086:
- {
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- NullCheck(L_26);
- bool L_28 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_26, L_27, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_28)
- {
- goto IL_00ad;
- }
- }
- IL_0093:
- {
- ObjectTranslator_t2020767555 * L_29 = V_0;
- intptr_t L_30 = ___L0;
- NullCheck(L_29);
- ObjectTranslator_Get_m1627229423(L_29, L_30, 2, (&V_7), /*hidden argument*/NULL);
- Transform_t3600365921 * L_31 = V_1;
- Vector3_t3722313464 L_32 = V_7;
- NullCheck(L_31);
- Transform_Translate_m1810197270(L_31, L_32, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0277;
- }
- IL_00ad:
- {
- int32_t L_33 = V_2;
- if ((!(((uint32_t)L_33) == ((uint32_t)5))))
- {
- goto IL_0126;
- }
- }
- IL_00b4:
- {
- intptr_t L_34 = ___L0;
- int32_t L_35 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_35) == ((uint32_t)3))))
- {
- goto IL_0126;
- }
- }
- IL_00c1:
- {
- intptr_t L_36 = ___L0;
- int32_t L_37 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_37) == ((uint32_t)3))))
- {
- goto IL_0126;
- }
- }
- IL_00ce:
- {
- intptr_t L_38 = ___L0;
- int32_t L_39 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_38, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_39) == ((uint32_t)3))))
- {
- goto IL_0126;
- }
- }
- IL_00db:
- {
- ObjectTranslator_t2020767555 * L_40 = V_0;
- intptr_t L_41 = ___L0;
- NullCheck(L_40);
- bool L_42 = ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192(L_40, L_41, 5, /*hidden argument*/ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_RuntimeMethod_var);
- if (!L_42)
- {
- goto IL_0126;
- }
- }
- IL_00e8:
- {
- intptr_t L_43 = ___L0;
- double L_44 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_43, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_44)));
- intptr_t L_45 = ___L0;
- double L_46 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_45, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_46)));
- intptr_t L_47 = ___L0;
- double L_48 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_47, 4, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_48)));
- ObjectTranslator_t2020767555 * L_49 = V_0;
- intptr_t L_50 = ___L0;
- NullCheck(L_49);
- ObjectTranslator_Get_TisSpace_t654135784_m3053450216(L_49, L_50, 5, (&V_11), /*hidden argument*/ObjectTranslator_Get_TisSpace_t654135784_m3053450216_RuntimeMethod_var);
- Transform_t3600365921 * L_51 = V_1;
- float L_52 = V_8;
- float L_53 = V_9;
- float L_54 = V_10;
- int32_t L_55 = V_11;
- NullCheck(L_51);
- Transform_Translate_m2198936091(L_51, L_52, L_53, L_54, L_55, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0277;
- }
- IL_0126:
- {
- int32_t L_56 = V_2;
- if ((!(((uint32_t)L_56) == ((uint32_t)5))))
- {
- goto IL_01ae;
- }
- }
- IL_012d:
- {
- intptr_t L_57 = ___L0;
- int32_t L_58 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_57, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_58) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_013a:
- {
- intptr_t L_59 = ___L0;
- int32_t L_60 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_59, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_60) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_0147:
- {
- intptr_t L_61 = ___L0;
- int32_t L_62 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_61, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_62) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_0154:
- {
- ObjectTranslator_t2020767555 * L_63 = V_0;
- intptr_t L_64 = ___L0;
- NullCheck(L_63);
- bool L_65 = ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(L_63, L_64, 5, /*hidden argument*/ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var);
- if (!L_65)
- {
- goto IL_01ae;
- }
- }
- IL_0161:
- {
- intptr_t L_66 = ___L0;
- double L_67 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_66, 2, /*hidden argument*/NULL);
- V_12 = (((float)((float)L_67)));
- intptr_t L_68 = ___L0;
- double L_69 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_68, 3, /*hidden argument*/NULL);
- V_13 = (((float)((float)L_69)));
- intptr_t L_70 = ___L0;
- double L_71 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_70, 4, /*hidden argument*/NULL);
- V_14 = (((float)((float)L_71)));
- ObjectTranslator_t2020767555 * L_72 = V_0;
- intptr_t L_73 = ___L0;
- RuntimeTypeHandle_t3027515415 L_74 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_75 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_74, /*hidden argument*/NULL);
- NullCheck(L_72);
- RuntimeObject * L_76 = ObjectTranslator_GetObject_m805173647(L_72, L_73, 5, L_75, /*hidden argument*/NULL);
- V_15 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_76, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_77 = V_1;
- float L_78 = V_12;
- float L_79 = V_13;
- float L_80 = V_14;
- Transform_t3600365921 * L_81 = V_15;
- NullCheck(L_77);
- Transform_Translate_m182585230(L_77, L_78, L_79, L_80, L_81, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0277;
- }
- IL_01ae:
- {
- int32_t L_82 = V_2;
- if ((!(((uint32_t)L_82) == ((uint32_t)3))))
- {
- goto IL_01f5;
- }
- }
- IL_01b5:
- {
- ObjectTranslator_t2020767555 * L_83 = V_0;
- intptr_t L_84 = ___L0;
- NullCheck(L_83);
- bool L_85 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_83, L_84, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_85)
- {
- goto IL_01f5;
- }
- }
- IL_01c2:
- {
- ObjectTranslator_t2020767555 * L_86 = V_0;
- intptr_t L_87 = ___L0;
- NullCheck(L_86);
- bool L_88 = ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192(L_86, L_87, 3, /*hidden argument*/ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_RuntimeMethod_var);
- if (!L_88)
- {
- goto IL_01f5;
- }
- }
- IL_01cf:
- {
- ObjectTranslator_t2020767555 * L_89 = V_0;
- intptr_t L_90 = ___L0;
- NullCheck(L_89);
- ObjectTranslator_Get_m1627229423(L_89, L_90, 2, (&V_16), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_91 = V_0;
- intptr_t L_92 = ___L0;
- NullCheck(L_91);
- ObjectTranslator_Get_TisSpace_t654135784_m3053450216(L_91, L_92, 3, (&V_17), /*hidden argument*/ObjectTranslator_Get_TisSpace_t654135784_m3053450216_RuntimeMethod_var);
- Transform_t3600365921 * L_93 = V_1;
- Vector3_t3722313464 L_94 = V_16;
- int32_t L_95 = V_17;
- NullCheck(L_93);
- Transform_Translate_m1990195114(L_93, L_94, L_95, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0277;
- }
- IL_01f5:
- {
- int32_t L_96 = V_2;
- if ((!(((uint32_t)L_96) == ((uint32_t)3))))
- {
- goto IL_024b;
- }
- }
- IL_01fc:
- {
- ObjectTranslator_t2020767555 * L_97 = V_0;
- intptr_t L_98 = ___L0;
- NullCheck(L_97);
- bool L_99 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_97, L_98, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_99)
- {
- goto IL_024b;
- }
- }
- IL_0209:
- {
- ObjectTranslator_t2020767555 * L_100 = V_0;
- intptr_t L_101 = ___L0;
- NullCheck(L_100);
- bool L_102 = ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(L_100, L_101, 3, /*hidden argument*/ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var);
- if (!L_102)
- {
- goto IL_024b;
- }
- }
- IL_0216:
- {
- ObjectTranslator_t2020767555 * L_103 = V_0;
- intptr_t L_104 = ___L0;
- NullCheck(L_103);
- ObjectTranslator_Get_m1627229423(L_103, L_104, 2, (&V_18), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_105 = V_0;
- intptr_t L_106 = ___L0;
- RuntimeTypeHandle_t3027515415 L_107 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_108 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_107, /*hidden argument*/NULL);
- NullCheck(L_105);
- RuntimeObject * L_109 = ObjectTranslator_GetObject_m805173647(L_105, L_106, 3, L_108, /*hidden argument*/NULL);
- V_19 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_109, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_110 = V_1;
- Vector3_t3722313464 L_111 = V_18;
- Transform_t3600365921 * L_112 = V_19;
- NullCheck(L_110);
- Transform_Translate_m1458128769(L_110, L_111, L_112, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0277;
- }
- IL_024b:
- {
- goto IL_026b;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0250;
- throw e;
- }
- CATCH_0250:
- { // begin catch(System.Exception)
- V_20 = ((Exception_t *)__exception_local);
- intptr_t L_113 = ___L0;
- Exception_t * L_114 = V_20;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_115 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_114, /*hidden argument*/NULL);
- int32_t L_116 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_113, L_115, /*hidden argument*/NULL);
- V_6 = L_116;
- goto IL_0277;
- } // end catch (depth: 1)
- IL_026b:
- {
- intptr_t L_117 = ___L0;
- int32_t L_118 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_117, _stringLiteral2847057996, /*hidden argument*/NULL);
- return L_118;
- }
- IL_0277:
- {
- int32_t L_119 = V_6;
- return L_119;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_Rotate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_Rotate_m1066480346 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_Rotate_m1066480346_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- int32_t V_6 = 0;
- Vector3_t3722313464 V_7;
- memset(&V_7, 0, sizeof(V_7));
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- float V_10 = 0.0f;
- float V_11 = 0.0f;
- float V_12 = 0.0f;
- int32_t V_13 = 0;
- Vector3_t3722313464 V_14;
- memset(&V_14, 0, sizeof(V_14));
- int32_t V_15 = 0;
- Vector3_t3722313464 V_16;
- memset(&V_16, 0, sizeof(V_16));
- float V_17 = 0.0f;
- int32_t V_18 = 0;
- Exception_t * V_19 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_007f;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_007f;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_007f;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_007f;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Transform_Rotate_m3172098886(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0240;
- }
- IL_007f:
- {
- int32_t L_25 = V_2;
- if ((!(((uint32_t)L_25) == ((uint32_t)2))))
- {
- goto IL_00ad;
- }
- }
- IL_0086:
- {
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- NullCheck(L_26);
- bool L_28 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_26, L_27, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_28)
- {
- goto IL_00ad;
- }
- }
- IL_0093:
- {
- ObjectTranslator_t2020767555 * L_29 = V_0;
- intptr_t L_30 = ___L0;
- NullCheck(L_29);
- ObjectTranslator_Get_m1627229423(L_29, L_30, 2, (&V_7), /*hidden argument*/NULL);
- Transform_t3600365921 * L_31 = V_1;
- Vector3_t3722313464 L_32 = V_7;
- NullCheck(L_31);
- Transform_Rotate_m720511863(L_31, L_32, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0240;
- }
- IL_00ad:
- {
- int32_t L_33 = V_2;
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00f4;
- }
- }
- IL_00b4:
- {
- ObjectTranslator_t2020767555 * L_34 = V_0;
- intptr_t L_35 = ___L0;
- NullCheck(L_34);
- bool L_36 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_34, L_35, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_36)
- {
- goto IL_00f4;
- }
- }
- IL_00c1:
- {
- intptr_t L_37 = ___L0;
- int32_t L_38 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_37, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_38) == ((uint32_t)3))))
- {
- goto IL_00f4;
- }
- }
- IL_00ce:
- {
- ObjectTranslator_t2020767555 * L_39 = V_0;
- intptr_t L_40 = ___L0;
- NullCheck(L_39);
- ObjectTranslator_Get_m1627229423(L_39, L_40, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_41 = ___L0;
- double L_42 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_41, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_42)));
- Transform_t3600365921 * L_43 = V_1;
- Vector3_t3722313464 L_44 = V_8;
- float L_45 = V_9;
- NullCheck(L_43);
- Transform_Rotate_m1749346957(L_43, L_44, L_45, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0240;
- }
- IL_00f4:
- {
- int32_t L_46 = V_2;
- if ((!(((uint32_t)L_46) == ((uint32_t)5))))
- {
- goto IL_016d;
- }
- }
- IL_00fb:
- {
- intptr_t L_47 = ___L0;
- int32_t L_48 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_47, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_48) == ((uint32_t)3))))
- {
- goto IL_016d;
- }
- }
- IL_0108:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_49, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_50) == ((uint32_t)3))))
- {
- goto IL_016d;
- }
- }
- IL_0115:
- {
- intptr_t L_51 = ___L0;
- int32_t L_52 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_51, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_52) == ((uint32_t)3))))
- {
- goto IL_016d;
- }
- }
- IL_0122:
- {
- ObjectTranslator_t2020767555 * L_53 = V_0;
- intptr_t L_54 = ___L0;
- NullCheck(L_53);
- bool L_55 = ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192(L_53, L_54, 5, /*hidden argument*/ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_RuntimeMethod_var);
- if (!L_55)
- {
- goto IL_016d;
- }
- }
- IL_012f:
- {
- intptr_t L_56 = ___L0;
- double L_57 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_56, 2, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_57)));
- intptr_t L_58 = ___L0;
- double L_59 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_58, 3, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_59)));
- intptr_t L_60 = ___L0;
- double L_61 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_60, 4, /*hidden argument*/NULL);
- V_12 = (((float)((float)L_61)));
- ObjectTranslator_t2020767555 * L_62 = V_0;
- intptr_t L_63 = ___L0;
- NullCheck(L_62);
- ObjectTranslator_Get_TisSpace_t654135784_m3053450216(L_62, L_63, 5, (&V_13), /*hidden argument*/ObjectTranslator_Get_TisSpace_t654135784_m3053450216_RuntimeMethod_var);
- Transform_t3600365921 * L_64 = V_1;
- float L_65 = V_10;
- float L_66 = V_11;
- float L_67 = V_12;
- int32_t L_68 = V_13;
- NullCheck(L_64);
- Transform_Rotate_m1660364534(L_64, L_65, L_66, L_67, L_68, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0240;
- }
- IL_016d:
- {
- int32_t L_69 = V_2;
- if ((!(((uint32_t)L_69) == ((uint32_t)3))))
- {
- goto IL_01b4;
- }
- }
- IL_0174:
- {
- ObjectTranslator_t2020767555 * L_70 = V_0;
- intptr_t L_71 = ___L0;
- NullCheck(L_70);
- bool L_72 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_70, L_71, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_72)
- {
- goto IL_01b4;
- }
- }
- IL_0181:
- {
- ObjectTranslator_t2020767555 * L_73 = V_0;
- intptr_t L_74 = ___L0;
- NullCheck(L_73);
- bool L_75 = ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192(L_73, L_74, 3, /*hidden argument*/ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_RuntimeMethod_var);
- if (!L_75)
- {
- goto IL_01b4;
- }
- }
- IL_018e:
- {
- ObjectTranslator_t2020767555 * L_76 = V_0;
- intptr_t L_77 = ___L0;
- NullCheck(L_76);
- ObjectTranslator_Get_m1627229423(L_76, L_77, 2, (&V_14), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_78 = V_0;
- intptr_t L_79 = ___L0;
- NullCheck(L_78);
- ObjectTranslator_Get_TisSpace_t654135784_m3053450216(L_78, L_79, 3, (&V_15), /*hidden argument*/ObjectTranslator_Get_TisSpace_t654135784_m3053450216_RuntimeMethod_var);
- Transform_t3600365921 * L_80 = V_1;
- Vector3_t3722313464 L_81 = V_14;
- int32_t L_82 = V_15;
- NullCheck(L_80);
- Transform_Rotate_m1886816857(L_80, L_81, L_82, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0240;
- }
- IL_01b4:
- {
- int32_t L_83 = V_2;
- if ((!(((uint32_t)L_83) == ((uint32_t)4))))
- {
- goto IL_0214;
- }
- }
- IL_01bb:
- {
- ObjectTranslator_t2020767555 * L_84 = V_0;
- intptr_t L_85 = ___L0;
- NullCheck(L_84);
- bool L_86 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_84, L_85, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_86)
- {
- goto IL_0214;
- }
- }
- IL_01c8:
- {
- intptr_t L_87 = ___L0;
- int32_t L_88 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_87, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_88) == ((uint32_t)3))))
- {
- goto IL_0214;
- }
- }
- IL_01d5:
- {
- ObjectTranslator_t2020767555 * L_89 = V_0;
- intptr_t L_90 = ___L0;
- NullCheck(L_89);
- bool L_91 = ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192(L_89, L_90, 4, /*hidden argument*/ObjectTranslator_Assignable_TisSpace_t654135784_m3513239192_RuntimeMethod_var);
- if (!L_91)
- {
- goto IL_0214;
- }
- }
- IL_01e2:
- {
- ObjectTranslator_t2020767555 * L_92 = V_0;
- intptr_t L_93 = ___L0;
- NullCheck(L_92);
- ObjectTranslator_Get_m1627229423(L_92, L_93, 2, (&V_16), /*hidden argument*/NULL);
- intptr_t L_94 = ___L0;
- double L_95 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_94, 3, /*hidden argument*/NULL);
- V_17 = (((float)((float)L_95)));
- ObjectTranslator_t2020767555 * L_96 = V_0;
- intptr_t L_97 = ___L0;
- NullCheck(L_96);
- ObjectTranslator_Get_TisSpace_t654135784_m3053450216(L_96, L_97, 4, (&V_18), /*hidden argument*/ObjectTranslator_Get_TisSpace_t654135784_m3053450216_RuntimeMethod_var);
- Transform_t3600365921 * L_98 = V_1;
- Vector3_t3722313464 L_99 = V_16;
- float L_100 = V_17;
- int32_t L_101 = V_18;
- NullCheck(L_98);
- Transform_Rotate_m1538690078(L_98, L_99, L_100, L_101, /*hidden argument*/NULL);
- V_6 = 0;
- goto IL_0240;
- }
- IL_0214:
- {
- goto IL_0234;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0219;
- throw e;
- }
- CATCH_0219:
- { // begin catch(System.Exception)
- V_19 = ((Exception_t *)__exception_local);
- intptr_t L_102 = ___L0;
- Exception_t * L_103 = V_19;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_104 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_103, /*hidden argument*/NULL);
- int32_t L_105 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_102, L_104, /*hidden argument*/NULL);
- V_6 = L_105;
- goto IL_0240;
- } // end catch (depth: 1)
- IL_0234:
- {
- intptr_t L_106 = ___L0;
- int32_t L_107 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_106, _stringLiteral2170683248, /*hidden argument*/NULL);
- return L_107;
- }
- IL_0240:
- {
- int32_t L_108 = V_6;
- return L_108;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_RotateAround(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_RotateAround_m3000108533 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_RotateAround_m3000108533_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- NullCheck(L_8);
- ObjectTranslator_Get_m1627229423(L_8, L_9, 3, (&V_3), /*hidden argument*/NULL);
- intptr_t L_10 = ___L0;
- double L_11 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_10, 4, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_11)));
- Transform_t3600365921 * L_12 = V_1;
- Vector3_t3722313464 L_13 = V_2;
- Vector3_t3722313464 L_14 = V_3;
- float L_15 = V_4;
- NullCheck(L_12);
- Transform_RotateAround_m2651195670(L_12, L_13, L_14, L_15, /*hidden argument*/NULL);
- V_5 = 0;
- goto IL_0065;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_004a;
- throw e;
- }
- CATCH_004a:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_5 = L_19;
- goto IL_0065;
- } // end catch (depth: 1)
- IL_0065:
- {
- int32_t L_20 = V_5;
- return L_20;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_LookAt(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_LookAt_m1878060840 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_LookAt_m1878060840_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Transform_t3600365921 * V_3 = NULL;
- int32_t V_4 = 0;
- Vector3_t3722313464 V_5;
- memset(&V_5, 0, sizeof(V_5));
- Transform_t3600365921 * V_6 = NULL;
- Vector3_t3722313464 V_7;
- memset(&V_7, 0, sizeof(V_7));
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)2))))
- {
- goto IL_005c;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_005c;
- }
- }
- IL_0035:
- {
- ObjectTranslator_t2020767555 * L_12 = V_0;
- intptr_t L_13 = ___L0;
- RuntimeTypeHandle_t3027515415 L_14 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_15 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_14, /*hidden argument*/NULL);
- NullCheck(L_12);
- RuntimeObject * L_16 = ObjectTranslator_GetObject_m805173647(L_12, L_13, 2, L_15, /*hidden argument*/NULL);
- V_3 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_16, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_17 = V_1;
- Transform_t3600365921 * L_18 = V_3;
- NullCheck(L_17);
- Transform_LookAt_m3968184312(L_17, L_18, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_0153;
- }
- IL_005c:
- {
- int32_t L_19 = V_2;
- if ((!(((uint32_t)L_19) == ((uint32_t)2))))
- {
- goto IL_008a;
- }
- }
- IL_0063:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- NullCheck(L_20);
- bool L_22 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_20, L_21, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_22)
- {
- goto IL_008a;
- }
- }
- IL_0070:
- {
- ObjectTranslator_t2020767555 * L_23 = V_0;
- intptr_t L_24 = ___L0;
- NullCheck(L_23);
- ObjectTranslator_Get_m1627229423(L_23, L_24, 2, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_25 = V_1;
- Vector3_t3722313464 L_26 = V_5;
- NullCheck(L_25);
- Transform_LookAt_m3649447396(L_25, L_26, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_0153;
- }
- IL_008a:
- {
- int32_t L_27 = V_2;
- if ((!(((uint32_t)L_27) == ((uint32_t)3))))
- {
- goto IL_00e0;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_28 = V_0;
- intptr_t L_29 = ___L0;
- NullCheck(L_28);
- bool L_30 = ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105(L_28, L_29, 2, /*hidden argument*/ObjectTranslator_Assignable_TisTransform_t3600365921_m3452738105_RuntimeMethod_var);
- if (!L_30)
- {
- goto IL_00e0;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- NullCheck(L_31);
- bool L_33 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_31, L_32, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_33)
- {
- goto IL_00e0;
- }
- }
- IL_00ab:
- {
- ObjectTranslator_t2020767555 * L_34 = V_0;
- intptr_t L_35 = ___L0;
- RuntimeTypeHandle_t3027515415 L_36 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_37 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_36, /*hidden argument*/NULL);
- NullCheck(L_34);
- RuntimeObject * L_38 = ObjectTranslator_GetObject_m805173647(L_34, L_35, 2, L_37, /*hidden argument*/NULL);
- V_6 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_38, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_39 = V_0;
- intptr_t L_40 = ___L0;
- NullCheck(L_39);
- ObjectTranslator_Get_m1627229423(L_39, L_40, 3, (&V_7), /*hidden argument*/NULL);
- Transform_t3600365921 * L_41 = V_1;
- Transform_t3600365921 * L_42 = V_6;
- Vector3_t3722313464 L_43 = V_7;
- NullCheck(L_41);
- Transform_LookAt_m2637417695(L_41, L_42, L_43, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_0153;
- }
- IL_00e0:
- {
- int32_t L_44 = V_2;
- if ((!(((uint32_t)L_44) == ((uint32_t)3))))
- {
- goto IL_0127;
- }
- }
- IL_00e7:
- {
- ObjectTranslator_t2020767555 * L_45 = V_0;
- intptr_t L_46 = ___L0;
- NullCheck(L_45);
- bool L_47 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_45, L_46, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_47)
- {
- goto IL_0127;
- }
- }
- IL_00f4:
- {
- ObjectTranslator_t2020767555 * L_48 = V_0;
- intptr_t L_49 = ___L0;
- NullCheck(L_48);
- bool L_50 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_48, L_49, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_50)
- {
- goto IL_0127;
- }
- }
- IL_0101:
- {
- ObjectTranslator_t2020767555 * L_51 = V_0;
- intptr_t L_52 = ___L0;
- NullCheck(L_51);
- ObjectTranslator_Get_m1627229423(L_51, L_52, 2, (&V_8), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_53 = V_0;
- intptr_t L_54 = ___L0;
- NullCheck(L_53);
- ObjectTranslator_Get_m1627229423(L_53, L_54, 3, (&V_9), /*hidden argument*/NULL);
- Transform_t3600365921 * L_55 = V_1;
- Vector3_t3722313464 L_56 = V_8;
- Vector3_t3722313464 L_57 = V_9;
- NullCheck(L_55);
- Transform_LookAt_m3639503211(L_55, L_56, L_57, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_0153;
- }
- IL_0127:
- {
- goto IL_0147;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_012c;
- throw e;
- }
- CATCH_012c:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_58 = ___L0;
- Exception_t * L_59 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_60 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_59, /*hidden argument*/NULL);
- int32_t L_61 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_58, L_60, /*hidden argument*/NULL);
- V_4 = L_61;
- goto IL_0153;
- } // end catch (depth: 1)
- IL_0147:
- {
- intptr_t L_62 = ___L0;
- int32_t L_63 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_62, _stringLiteral1462846399, /*hidden argument*/NULL);
- return L_63;
- }
- IL_0153:
- {
- int32_t L_64 = V_4;
- return L_64;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_TransformDirection(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_TransformDirection_m4138306096 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_TransformDirection_m4138306096_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- Vector3_t3722313464 V_6;
- memset(&V_6, 0, sizeof(V_6));
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Vector3_t3722313464 L_25 = Transform_TransformDirection_m3193513622(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- Vector3_t3722313464 L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_008a:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)2))))
- {
- goto IL_00c3;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- bool L_32 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_30, L_31, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_32)
- {
- goto IL_00c3;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_33 = V_0;
- intptr_t L_34 = ___L0;
- NullCheck(L_33);
- ObjectTranslator_Get_m1627229423(L_33, L_34, 2, (&V_8), /*hidden argument*/NULL);
- Transform_t3600365921 * L_35 = V_1;
- Vector3_t3722313464 L_36 = V_8;
- NullCheck(L_35);
- Vector3_t3722313464 L_37 = Transform_TransformDirection_m3784028109(L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- Vector3_t3722313464 L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_7 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral2255970592, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_7;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_InverseTransformDirection(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_InverseTransformDirection_m2522909164_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- Vector3_t3722313464 V_6;
- memset(&V_6, 0, sizeof(V_6));
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Vector3_t3722313464 L_25 = Transform_InverseTransformDirection_m351876368(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- Vector3_t3722313464 L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_008a:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)2))))
- {
- goto IL_00c3;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- bool L_32 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_30, L_31, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_32)
- {
- goto IL_00c3;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_33 = V_0;
- intptr_t L_34 = ___L0;
- NullCheck(L_33);
- ObjectTranslator_Get_m1627229423(L_33, L_34, 2, (&V_8), /*hidden argument*/NULL);
- Transform_t3600365921 * L_35 = V_1;
- Vector3_t3722313464 L_36 = V_8;
- NullCheck(L_35);
- Vector3_t3722313464 L_37 = Transform_InverseTransformDirection_m3843238577(L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- Vector3_t3722313464 L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_7 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral3338612227, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_7;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_TransformVector(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_TransformVector_m1514244944 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_TransformVector_m1514244944_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- Vector3_t3722313464 V_6;
- memset(&V_6, 0, sizeof(V_6));
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Vector3_t3722313464 L_25 = Transform_TransformVector_m1386854030(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- Vector3_t3722313464 L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_008a:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)2))))
- {
- goto IL_00c3;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- bool L_32 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_30, L_31, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_32)
- {
- goto IL_00c3;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_33 = V_0;
- intptr_t L_34 = ___L0;
- NullCheck(L_33);
- ObjectTranslator_Get_m1627229423(L_33, L_34, 2, (&V_8), /*hidden argument*/NULL);
- Transform_t3600365921 * L_35 = V_1;
- Vector3_t3722313464 L_36 = V_8;
- NullCheck(L_35);
- Vector3_t3722313464 L_37 = Transform_TransformVector_m1951285617(L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- Vector3_t3722313464 L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_7 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral154830841, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_7;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_InverseTransformVector(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_InverseTransformVector_m1349495655 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_InverseTransformVector_m1349495655_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- Vector3_t3722313464 V_6;
- memset(&V_6, 0, sizeof(V_6));
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Vector3_t3722313464 L_25 = Transform_InverseTransformVector_m1918399765(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- Vector3_t3722313464 L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_008a:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)2))))
- {
- goto IL_00c3;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- bool L_32 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_30, L_31, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_32)
- {
- goto IL_00c3;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_33 = V_0;
- intptr_t L_34 = ___L0;
- NullCheck(L_33);
- ObjectTranslator_Get_m1627229423(L_33, L_34, 2, (&V_8), /*hidden argument*/NULL);
- Transform_t3600365921 * L_35 = V_1;
- Vector3_t3722313464 L_36 = V_8;
- NullCheck(L_35);
- Vector3_t3722313464 L_37 = Transform_InverseTransformVector_m3855973661(L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- Vector3_t3722313464 L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_7 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral1851749169, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_7;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_TransformPoint(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_TransformPoint_m1078881144 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_TransformPoint_m1078881144_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- Vector3_t3722313464 V_6;
- memset(&V_6, 0, sizeof(V_6));
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Vector3_t3722313464 L_25 = Transform_TransformPoint_m4024714202(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- Vector3_t3722313464 L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_008a:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)2))))
- {
- goto IL_00c3;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- bool L_32 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_30, L_31, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_32)
- {
- goto IL_00c3;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_33 = V_0;
- intptr_t L_34 = ___L0;
- NullCheck(L_33);
- ObjectTranslator_Get_m1627229423(L_33, L_34, 2, (&V_8), /*hidden argument*/NULL);
- Transform_t3600365921 * L_35 = V_1;
- Vector3_t3722313464 L_36 = V_8;
- NullCheck(L_35);
- Vector3_t3722313464 L_37 = Transform_TransformPoint_m226827784(L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- Vector3_t3722313464 L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_7 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral3485366427, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_7;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_InverseTransformPoint(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_InverseTransformPoint_m957968118 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_InverseTransformPoint_m957968118_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- Vector3_t3722313464 V_6;
- memset(&V_6, 0, sizeof(V_6));
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_20)));
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- float L_24 = V_5;
- NullCheck(L_21);
- Vector3_t3722313464 L_25 = Transform_InverseTransformPoint_m1060740552(L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- Vector3_t3722313464 L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_008a:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)2))))
- {
- goto IL_00c3;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- bool L_32 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_30, L_31, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_32)
- {
- goto IL_00c3;
- }
- }
- IL_009e:
- {
- ObjectTranslator_t2020767555 * L_33 = V_0;
- intptr_t L_34 = ___L0;
- NullCheck(L_33);
- ObjectTranslator_Get_m1627229423(L_33, L_34, 2, (&V_8), /*hidden argument*/NULL);
- Transform_t3600365921 * L_35 = V_1;
- Vector3_t3722313464 L_36 = V_8;
- NullCheck(L_35);
- Vector3_t3722313464 L_37 = Transform_InverseTransformPoint_m1343916000(L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- Vector3_t3722313464 L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_7 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral1960680026, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_7;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DetachChildren(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DetachChildren_m520041245 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DetachChildren_m520041245_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- NullCheck(L_6);
- Transform_DetachChildren_m3266231651(L_6, /*hidden argument*/NULL);
- V_2 = 0;
- goto IL_003f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0027;
- throw e;
- }
- CATCH_0027:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_2 = L_10;
- goto IL_003f;
- } // end catch (depth: 1)
- IL_003f:
- {
- int32_t L_11 = V_2;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetAsFirstSibling(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_SetAsFirstSibling_m3710811233_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- NullCheck(L_6);
- Transform_SetAsFirstSibling_m253439912(L_6, /*hidden argument*/NULL);
- V_2 = 0;
- goto IL_003f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0027;
- throw e;
- }
- CATCH_0027:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_2 = L_10;
- goto IL_003f;
- } // end catch (depth: 1)
- IL_003f:
- {
- int32_t L_11 = V_2;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetAsLastSibling(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_SetAsLastSibling_m3350008101_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- NullCheck(L_6);
- Transform_SetAsLastSibling_m3949169710(L_6, /*hidden argument*/NULL);
- V_2 = 0;
- goto IL_003f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0027;
- throw e;
- }
- CATCH_0027:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_2 = L_10;
- goto IL_003f;
- } // end catch (depth: 1)
- IL_003f:
- {
- int32_t L_11 = V_2;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_SetSiblingIndex(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_SetSiblingIndex_m3078536120_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = L_7;
- Transform_t3600365921 * L_8 = V_1;
- int32_t L_9 = V_2;
- NullCheck(L_8);
- Transform_SetSiblingIndex_m1077399982(L_8, L_9, /*hidden argument*/NULL);
- V_3 = 0;
- goto IL_004a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_004a;
- } // end catch (depth: 1)
- IL_004a:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_GetSiblingIndex(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_GetSiblingIndex_m3741839283_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- NullCheck(L_6);
- int32_t L_7 = Transform_GetSiblingIndex_m798637244(L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- intptr_t L_8 = ___L0;
- int32_t L_9 = V_2;
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_8, L_9, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002f;
- throw e;
- }
- CATCH_002f:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0049;
- } // end catch (depth: 1)
- IL_0049:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_Find(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_Find_m1578719640 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_Find_m1578719640_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- String_t* V_2 = NULL;
- Transform_t3600365921 * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- String_t* L_7 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = L_7;
- Transform_t3600365921 * L_8 = V_1;
- String_t* L_9 = V_2;
- NullCheck(L_8);
- Transform_t3600365921 * L_10 = Transform_Find_m1729760951(L_8, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- Transform_t3600365921 * L_13 = V_3;
- NullCheck(L_11);
- ObjectTranslator_Push_m105918116(L_11, L_12, L_13, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0055;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003a;
- throw e;
- }
- CATCH_003a:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_14 = ___L0;
- Exception_t * L_15 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_16 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_15, /*hidden argument*/NULL);
- int32_t L_17 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_14, L_16, /*hidden argument*/NULL);
- V_4 = L_17;
- goto IL_0055;
- } // end catch (depth: 1)
- IL_0055:
- {
- int32_t L_18 = V_4;
- return L_18;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_IsChildOf(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_IsChildOf_m764668816 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_IsChildOf_m764668816_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Transform_t3600365921 * V_2 = NULL;
- bool V_3 = false;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- RuntimeTypeHandle_t3027515415 L_8 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_9 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- RuntimeObject * L_10 = ObjectTranslator_GetObject_m805173647(L_6, L_7, 2, L_9, /*hidden argument*/NULL);
- V_2 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_10, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_11 = V_1;
- Transform_t3600365921 * L_12 = V_2;
- NullCheck(L_11);
- bool L_13 = Transform_IsChildOf_m224006092(L_11, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- intptr_t L_14 = ___L0;
- bool L_15 = V_3;
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_14, L_15, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0064;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0049;
- throw e;
- }
- CATCH_0049:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_4 = L_19;
- goto IL_0064;
- } // end catch (depth: 1)
- IL_0064:
- {
- int32_t L_20 = V_4;
- return L_20;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_GetEnumerator(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_GetEnumerator_m2850786488 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_GetEnumerator_m2850786488_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- RuntimeObject* V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- NullCheck(L_6);
- RuntimeObject* L_7 = Transform_GetEnumerator_m2717073726(L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- RuntimeObject* L_10 = V_2;
- NullCheck(L_8);
- ObjectTranslator_PushAny_m2595410231(L_8, L_9, L_10, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_004a;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_11 = ___L0;
- Exception_t * L_12 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_13 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_12, /*hidden argument*/NULL);
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_11, L_13, /*hidden argument*/NULL);
- V_3 = L_14;
- goto IL_004a;
- } // end catch (depth: 1)
- IL_004a:
- {
- int32_t L_15 = V_3;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_GetChild(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_GetChild_m1976232125 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_GetChild_m1976232125_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Transform_t3600365921 * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = L_7;
- Transform_t3600365921 * L_8 = V_1;
- int32_t L_9 = V_2;
- NullCheck(L_8);
- Transform_t3600365921 * L_10 = Transform_GetChild_m1092972975(L_8, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- Transform_t3600365921 * L_13 = V_3;
- NullCheck(L_11);
- ObjectTranslator_Push_m105918116(L_11, L_12, L_13, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0055;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003a;
- throw e;
- }
- CATCH_003a:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_14 = ___L0;
- Exception_t * L_15 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_16 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_15, /*hidden argument*/NULL);
- int32_t L_17 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_14, L_16, /*hidden argument*/NULL);
- V_4 = L_17;
- goto IL_0055;
- } // end catch (depth: 1)
- IL_0055:
- {
- int32_t L_18 = V_4;
- return L_18;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMove(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMove_m2510464153 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOMove_m2510464153_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)1))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_16 = V_0;
- intptr_t L_17 = ___L0;
- NullCheck(L_16);
- ObjectTranslator_Get_m1627229423(L_16, L_17, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- double L_19 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_18, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_19)));
- intptr_t L_20 = ___L0;
- bool L_21 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_20, 4, /*hidden argument*/NULL);
- V_5 = L_21;
- Transform_t3600365921 * L_22 = V_1;
- Vector3_t3722313464 L_23 = V_3;
- float L_24 = V_4;
- bool L_25 = V_5;
- TweenerCore_3_t2944330537 * L_26 = ShortcutExtensions_DOMove_m2811406016(NULL /*static, unused*/, L_22, L_23, L_24, L_25, /*hidden argument*/NULL);
- V_6 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- TweenerCore_3_t2944330537 * L_29 = V_6;
- NullCheck(L_27);
- ObjectTranslator_Push_m105918116(L_27, L_28, L_29, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_008a:
- {
- int32_t L_30 = V_2;
- if ((!(((uint32_t)L_30) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- NullCheck(L_31);
- bool L_33 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_31, L_32, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_33)
- {
- goto IL_00dd;
- }
- }
- IL_009e:
- {
- intptr_t L_34 = ___L0;
- int32_t L_35 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_34, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_35) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_00ab:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- ObjectTranslator_Get_m1627229423(L_36, L_37, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- double L_39 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_38, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_39)));
- Transform_t3600365921 * L_40 = V_1;
- Vector3_t3722313464 L_41 = V_8;
- float L_42 = V_9;
- TweenerCore_3_t2944330537 * L_43 = ShortcutExtensions_DOMove_m2811406016(NULL /*static, unused*/, L_40, L_41, L_42, (bool)0, /*hidden argument*/NULL);
- V_10 = L_43;
- ObjectTranslator_t2020767555 * L_44 = V_0;
- intptr_t L_45 = ___L0;
- TweenerCore_3_t2944330537 * L_46 = V_10;
- NullCheck(L_44);
- ObjectTranslator_Push_m105918116(L_44, L_45, L_46, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_00dd:
- {
- goto IL_00fd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e2;
- throw e;
- }
- CATCH_00e2:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_47 = ___L0;
- Exception_t * L_48 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_49 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_48, /*hidden argument*/NULL);
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_47, L_49, /*hidden argument*/NULL);
- V_7 = L_50;
- goto IL_0109;
- } // end catch (depth: 1)
- IL_00fd:
- {
- intptr_t L_51 = ___L0;
- int32_t L_52 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_51, _stringLiteral1824945474, /*hidden argument*/NULL);
- return L_52;
- }
- IL_0109:
- {
- int32_t L_53 = V_7;
- return L_53;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMoveX(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMoveX_m427706497 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOMoveX_m427706497_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0089;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)1))))
- {
- goto IL_0089;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- bool L_20 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = L_20;
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- bool L_24 = V_5;
- TweenerCore_3_t2944330537 * L_25 = ShortcutExtensions_DOMoveX_m2454328326(NULL /*static, unused*/, L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- TweenerCore_3_t2944330537 * L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_Push_m105918116(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_0089:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_0090:
- {
- intptr_t L_30 = ___L0;
- int32_t L_31 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_30, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_009d:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_00aa:
- {
- intptr_t L_34 = ___L0;
- double L_35 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_35)));
- intptr_t L_36 = ___L0;
- double L_37 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_37)));
- Transform_t3600365921 * L_38 = V_1;
- float L_39 = V_8;
- float L_40 = V_9;
- TweenerCore_3_t2944330537 * L_41 = ShortcutExtensions_DOMoveX_m2454328326(NULL /*static, unused*/, L_38, L_39, L_40, (bool)0, /*hidden argument*/NULL);
- V_10 = L_41;
- ObjectTranslator_t2020767555 * L_42 = V_0;
- intptr_t L_43 = ___L0;
- TweenerCore_3_t2944330537 * L_44 = V_10;
- NullCheck(L_42);
- ObjectTranslator_Push_m105918116(L_42, L_43, L_44, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_00dc:
- {
- goto IL_00fc;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e1;
- throw e;
- }
- CATCH_00e1:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_45 = ___L0;
- Exception_t * L_46 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_47 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_46, /*hidden argument*/NULL);
- int32_t L_48 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, L_47, /*hidden argument*/NULL);
- V_7 = L_48;
- goto IL_0108;
- } // end catch (depth: 1)
- IL_00fc:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_49, _stringLiteral4216650904, /*hidden argument*/NULL);
- return L_50;
- }
- IL_0108:
- {
- int32_t L_51 = V_7;
- return L_51;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMoveY(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMoveY_m3829814726 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOMoveY_m3829814726_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0089;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)1))))
- {
- goto IL_0089;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- bool L_20 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = L_20;
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- bool L_24 = V_5;
- TweenerCore_3_t2944330537 * L_25 = ShortcutExtensions_DOMoveY_m3448206952(NULL /*static, unused*/, L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- TweenerCore_3_t2944330537 * L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_Push_m105918116(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_0089:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_0090:
- {
- intptr_t L_30 = ___L0;
- int32_t L_31 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_30, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_009d:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_00aa:
- {
- intptr_t L_34 = ___L0;
- double L_35 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_35)));
- intptr_t L_36 = ___L0;
- double L_37 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_37)));
- Transform_t3600365921 * L_38 = V_1;
- float L_39 = V_8;
- float L_40 = V_9;
- TweenerCore_3_t2944330537 * L_41 = ShortcutExtensions_DOMoveY_m3448206952(NULL /*static, unused*/, L_38, L_39, L_40, (bool)0, /*hidden argument*/NULL);
- V_10 = L_41;
- ObjectTranslator_t2020767555 * L_42 = V_0;
- intptr_t L_43 = ___L0;
- TweenerCore_3_t2944330537 * L_44 = V_10;
- NullCheck(L_42);
- ObjectTranslator_Push_m105918116(L_42, L_43, L_44, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_00dc:
- {
- goto IL_00fc;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e1;
- throw e;
- }
- CATCH_00e1:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_45 = ___L0;
- Exception_t * L_46 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_47 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_46, /*hidden argument*/NULL);
- int32_t L_48 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, L_47, /*hidden argument*/NULL);
- V_7 = L_48;
- goto IL_0108;
- } // end catch (depth: 1)
- IL_00fc:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_49, _stringLiteral4216716440, /*hidden argument*/NULL);
- return L_50;
- }
- IL_0108:
- {
- int32_t L_51 = V_7;
- return L_51;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOMoveZ(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOMoveZ_m3431864067 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOMoveZ_m3431864067_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0089;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)1))))
- {
- goto IL_0089;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- bool L_20 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = L_20;
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- bool L_24 = V_5;
- TweenerCore_3_t2944330537 * L_25 = ShortcutExtensions_DOMoveZ_m96258396(NULL /*static, unused*/, L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- TweenerCore_3_t2944330537 * L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_Push_m105918116(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_0089:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_0090:
- {
- intptr_t L_30 = ___L0;
- int32_t L_31 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_30, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_009d:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_00aa:
- {
- intptr_t L_34 = ___L0;
- double L_35 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_35)));
- intptr_t L_36 = ___L0;
- double L_37 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_37)));
- Transform_t3600365921 * L_38 = V_1;
- float L_39 = V_8;
- float L_40 = V_9;
- TweenerCore_3_t2944330537 * L_41 = ShortcutExtensions_DOMoveZ_m96258396(NULL /*static, unused*/, L_38, L_39, L_40, (bool)0, /*hidden argument*/NULL);
- V_10 = L_41;
- ObjectTranslator_t2020767555 * L_42 = V_0;
- intptr_t L_43 = ___L0;
- TweenerCore_3_t2944330537 * L_44 = V_10;
- NullCheck(L_42);
- ObjectTranslator_Push_m105918116(L_42, L_43, L_44, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_00dc:
- {
- goto IL_00fc;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e1;
- throw e;
- }
- CATCH_00e1:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_45 = ___L0;
- Exception_t * L_46 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_47 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_46, /*hidden argument*/NULL);
- int32_t L_48 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, L_47, /*hidden argument*/NULL);
- V_7 = L_48;
- goto IL_0108;
- } // end catch (depth: 1)
- IL_00fc:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_49, _stringLiteral4216519832, /*hidden argument*/NULL);
- return L_50;
- }
- IL_0108:
- {
- int32_t L_51 = V_7;
- return L_51;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMove(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMove_m602687662 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalMove_m602687662_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)1))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_16 = V_0;
- intptr_t L_17 = ___L0;
- NullCheck(L_16);
- ObjectTranslator_Get_m1627229423(L_16, L_17, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- double L_19 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_18, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_19)));
- intptr_t L_20 = ___L0;
- bool L_21 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_20, 4, /*hidden argument*/NULL);
- V_5 = L_21;
- Transform_t3600365921 * L_22 = V_1;
- Vector3_t3722313464 L_23 = V_3;
- float L_24 = V_4;
- bool L_25 = V_5;
- TweenerCore_3_t2944330537 * L_26 = ShortcutExtensions_DOLocalMove_m1613685430(NULL /*static, unused*/, L_22, L_23, L_24, L_25, /*hidden argument*/NULL);
- V_6 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- TweenerCore_3_t2944330537 * L_29 = V_6;
- NullCheck(L_27);
- ObjectTranslator_Push_m105918116(L_27, L_28, L_29, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_008a:
- {
- int32_t L_30 = V_2;
- if ((!(((uint32_t)L_30) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- NullCheck(L_31);
- bool L_33 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_31, L_32, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_33)
- {
- goto IL_00dd;
- }
- }
- IL_009e:
- {
- intptr_t L_34 = ___L0;
- int32_t L_35 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_34, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_35) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_00ab:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- ObjectTranslator_Get_m1627229423(L_36, L_37, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- double L_39 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_38, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_39)));
- Transform_t3600365921 * L_40 = V_1;
- Vector3_t3722313464 L_41 = V_8;
- float L_42 = V_9;
- TweenerCore_3_t2944330537 * L_43 = ShortcutExtensions_DOLocalMove_m1613685430(NULL /*static, unused*/, L_40, L_41, L_42, (bool)0, /*hidden argument*/NULL);
- V_10 = L_43;
- ObjectTranslator_t2020767555 * L_44 = V_0;
- intptr_t L_45 = ___L0;
- TweenerCore_3_t2944330537 * L_46 = V_10;
- NullCheck(L_44);
- ObjectTranslator_Push_m105918116(L_44, L_45, L_46, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_00dd:
- {
- goto IL_00fd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e2;
- throw e;
- }
- CATCH_00e2:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_47 = ___L0;
- Exception_t * L_48 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_49 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_48, /*hidden argument*/NULL);
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_47, L_49, /*hidden argument*/NULL);
- V_7 = L_50;
- goto IL_0109;
- } // end catch (depth: 1)
- IL_00fd:
- {
- intptr_t L_51 = ___L0;
- int32_t L_52 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_51, _stringLiteral3603685919, /*hidden argument*/NULL);
- return L_52;
- }
- IL_0109:
- {
- int32_t L_53 = V_7;
- return L_53;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMoveX(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalMoveX_m2893187224_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0089;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)1))))
- {
- goto IL_0089;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- bool L_20 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = L_20;
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- bool L_24 = V_5;
- TweenerCore_3_t2944330537 * L_25 = ShortcutExtensions_DOLocalMoveX_m2461473870(NULL /*static, unused*/, L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- TweenerCore_3_t2944330537 * L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_Push_m105918116(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_0089:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_0090:
- {
- intptr_t L_30 = ___L0;
- int32_t L_31 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_30, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_009d:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_00aa:
- {
- intptr_t L_34 = ___L0;
- double L_35 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_35)));
- intptr_t L_36 = ___L0;
- double L_37 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_37)));
- Transform_t3600365921 * L_38 = V_1;
- float L_39 = V_8;
- float L_40 = V_9;
- TweenerCore_3_t2944330537 * L_41 = ShortcutExtensions_DOLocalMoveX_m2461473870(NULL /*static, unused*/, L_38, L_39, L_40, (bool)0, /*hidden argument*/NULL);
- V_10 = L_41;
- ObjectTranslator_t2020767555 * L_42 = V_0;
- intptr_t L_43 = ___L0;
- TweenerCore_3_t2944330537 * L_44 = V_10;
- NullCheck(L_42);
- ObjectTranslator_Push_m105918116(L_42, L_43, L_44, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_00dc:
- {
- goto IL_00fc;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e1;
- throw e;
- }
- CATCH_00e1:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_45 = ___L0;
- Exception_t * L_46 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_47 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_46, /*hidden argument*/NULL);
- int32_t L_48 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, L_47, /*hidden argument*/NULL);
- V_7 = L_48;
- goto IL_0108;
- } // end catch (depth: 1)
- IL_00fc:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_49, _stringLiteral342541532, /*hidden argument*/NULL);
- return L_50;
- }
- IL_0108:
- {
- int32_t L_51 = V_7;
- return L_51;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMoveY(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalMoveY_m2263145027_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0089;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)1))))
- {
- goto IL_0089;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- bool L_20 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = L_20;
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- bool L_24 = V_5;
- TweenerCore_3_t2944330537 * L_25 = ShortcutExtensions_DOLocalMoveY_m2924342502(NULL /*static, unused*/, L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- TweenerCore_3_t2944330537 * L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_Push_m105918116(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_0089:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_0090:
- {
- intptr_t L_30 = ___L0;
- int32_t L_31 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_30, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_009d:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_00aa:
- {
- intptr_t L_34 = ___L0;
- double L_35 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_35)));
- intptr_t L_36 = ___L0;
- double L_37 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_37)));
- Transform_t3600365921 * L_38 = V_1;
- float L_39 = V_8;
- float L_40 = V_9;
- TweenerCore_3_t2944330537 * L_41 = ShortcutExtensions_DOLocalMoveY_m2924342502(NULL /*static, unused*/, L_38, L_39, L_40, (bool)0, /*hidden argument*/NULL);
- V_10 = L_41;
- ObjectTranslator_t2020767555 * L_42 = V_0;
- intptr_t L_43 = ___L0;
- TweenerCore_3_t2944330537 * L_44 = V_10;
- NullCheck(L_42);
- ObjectTranslator_Push_m105918116(L_42, L_43, L_44, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_00dc:
- {
- goto IL_00fc;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e1;
- throw e;
- }
- CATCH_00e1:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_45 = ___L0;
- Exception_t * L_46 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_47 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_46, /*hidden argument*/NULL);
- int32_t L_48 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, L_47, /*hidden argument*/NULL);
- V_7 = L_48;
- goto IL_0108;
- } // end catch (depth: 1)
- IL_00fc:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_49, _stringLiteral3071424887, /*hidden argument*/NULL);
- return L_50;
- }
- IL_0108:
- {
- int32_t L_51 = V_7;
- return L_51;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalMoveZ(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalMoveZ_m2125053865_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- bool V_5 = false;
- TweenerCore_3_t2944330537 * V_6 = NULL;
- int32_t V_7 = 0;
- float V_8 = 0.0f;
- float V_9 = 0.0f;
- TweenerCore_3_t2944330537 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0089;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0089;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)1))))
- {
- goto IL_0089;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_16)));
- intptr_t L_17 = ___L0;
- double L_18 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_17, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_18)));
- intptr_t L_19 = ___L0;
- bool L_20 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_19, 4, /*hidden argument*/NULL);
- V_5 = L_20;
- Transform_t3600365921 * L_21 = V_1;
- float L_22 = V_3;
- float L_23 = V_4;
- bool L_24 = V_5;
- TweenerCore_3_t2944330537 * L_25 = ShortcutExtensions_DOLocalMoveZ_m1503641773(NULL /*static, unused*/, L_21, L_22, L_23, L_24, /*hidden argument*/NULL);
- V_6 = L_25;
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- TweenerCore_3_t2944330537 * L_28 = V_6;
- NullCheck(L_26);
- ObjectTranslator_Push_m105918116(L_26, L_27, L_28, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_0089:
- {
- int32_t L_29 = V_2;
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_0090:
- {
- intptr_t L_30 = ___L0;
- int32_t L_31 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_30, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_009d:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_33) == ((uint32_t)3))))
- {
- goto IL_00dc;
- }
- }
- IL_00aa:
- {
- intptr_t L_34 = ___L0;
- double L_35 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_34, 2, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_35)));
- intptr_t L_36 = ___L0;
- double L_37 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_36, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_37)));
- Transform_t3600365921 * L_38 = V_1;
- float L_39 = V_8;
- float L_40 = V_9;
- TweenerCore_3_t2944330537 * L_41 = ShortcutExtensions_DOLocalMoveZ_m1503641773(NULL /*static, unused*/, L_38, L_39, L_40, (bool)0, /*hidden argument*/NULL);
- V_10 = L_41;
- ObjectTranslator_t2020767555 * L_42 = V_0;
- intptr_t L_43 = ___L0;
- TweenerCore_3_t2944330537 * L_44 = V_10;
- NullCheck(L_42);
- ObjectTranslator_Push_m105918116(L_42, L_43, L_44, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0108;
- }
- IL_00dc:
- {
- goto IL_00fc;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e1;
- throw e;
- }
- CATCH_00e1:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_45 = ___L0;
- Exception_t * L_46 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_47 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_46, /*hidden argument*/NULL);
- int32_t L_48 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, L_47, /*hidden argument*/NULL);
- V_7 = L_48;
- goto IL_0108;
- } // end catch (depth: 1)
- IL_00fc:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_49, _stringLiteral3474709414, /*hidden argument*/NULL);
- return L_50;
- }
- IL_0108:
- {
- int32_t L_51 = V_7;
- return L_51;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DORotate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DORotate_m825617719 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DORotate_m825617719_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- TweenerCore_3_t1299559007 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- TweenerCore_3_t1299559007 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008b;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008b;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008b;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_008b;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- NullCheck(L_17);
- ObjectTranslator_Get_m1627229423(L_17, L_18, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_20)));
- ObjectTranslator_t2020767555 * L_21 = V_0;
- intptr_t L_22 = ___L0;
- NullCheck(L_21);
- ObjectTranslator_Get_m1355366945(L_21, L_22, 4, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_23 = V_1;
- Vector3_t3722313464 L_24 = V_3;
- float L_25 = V_4;
- int32_t L_26 = V_5;
- TweenerCore_3_t1299559007 * L_27 = ShortcutExtensions_DORotate_m1865406243(NULL /*static, unused*/, L_23, L_24, L_25, L_26, /*hidden argument*/NULL);
- V_6 = L_27;
- ObjectTranslator_t2020767555 * L_28 = V_0;
- intptr_t L_29 = ___L0;
- TweenerCore_3_t1299559007 * L_30 = V_6;
- NullCheck(L_28);
- ObjectTranslator_Push_m105918116(L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_008b:
- {
- int32_t L_31 = V_2;
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_0092:
- {
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- NullCheck(L_32);
- bool L_34 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_32, L_33, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_34)
- {
- goto IL_00de;
- }
- }
- IL_009f:
- {
- intptr_t L_35 = ___L0;
- int32_t L_36 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_35, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_36) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_00ac:
- {
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- NullCheck(L_37);
- ObjectTranslator_Get_m1627229423(L_37, L_38, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_39 = ___L0;
- double L_40 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_40)));
- Transform_t3600365921 * L_41 = V_1;
- Vector3_t3722313464 L_42 = V_8;
- float L_43 = V_9;
- TweenerCore_3_t1299559007 * L_44 = ShortcutExtensions_DORotate_m1865406243(NULL /*static, unused*/, L_41, L_42, L_43, 0, /*hidden argument*/NULL);
- V_10 = L_44;
- ObjectTranslator_t2020767555 * L_45 = V_0;
- intptr_t L_46 = ___L0;
- TweenerCore_3_t1299559007 * L_47 = V_10;
- NullCheck(L_45);
- ObjectTranslator_Push_m105918116(L_45, L_46, L_47, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_00de:
- {
- goto IL_00fe;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e3;
- throw e;
- }
- CATCH_00e3:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_48 = ___L0;
- Exception_t * L_49 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_50 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_49, /*hidden argument*/NULL);
- int32_t L_51 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_48, L_50, /*hidden argument*/NULL);
- V_7 = L_51;
- goto IL_010a;
- } // end catch (depth: 1)
- IL_00fe:
- {
- intptr_t L_52 = ___L0;
- int32_t L_53 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_52, _stringLiteral3084911464, /*hidden argument*/NULL);
- return L_53;
- }
- IL_010a:
- {
- int32_t L_54 = V_7;
- return L_54;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DORotateQuaternion(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DORotateQuaternion_m2067513720_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Quaternion_t2301928331 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- TweenerCore_3_t3785815898 * V_4 = NULL;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m3946340519(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- Transform_t3600365921 * L_10 = V_1;
- Quaternion_t2301928331 L_11 = V_2;
- float L_12 = V_3;
- TweenerCore_3_t3785815898 * L_13 = ShortcutExtensions_DORotateQuaternion_m3329673556(NULL /*static, unused*/, L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- TweenerCore_3_t3785815898 * L_16 = V_4;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_0063;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0048;
- throw e;
- }
- CATCH_0048:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- goto IL_0063;
- } // end catch (depth: 1)
- IL_0063:
- {
- int32_t L_21 = V_5;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalRotate(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalRotate_m4095437176 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalRotate_m4095437176_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- TweenerCore_3_t1299559007 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- TweenerCore_3_t1299559007 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008b;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008b;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008b;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_008b;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- NullCheck(L_17);
- ObjectTranslator_Get_m1627229423(L_17, L_18, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_20)));
- ObjectTranslator_t2020767555 * L_21 = V_0;
- intptr_t L_22 = ___L0;
- NullCheck(L_21);
- ObjectTranslator_Get_m1355366945(L_21, L_22, 4, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_23 = V_1;
- Vector3_t3722313464 L_24 = V_3;
- float L_25 = V_4;
- int32_t L_26 = V_5;
- TweenerCore_3_t1299559007 * L_27 = ShortcutExtensions_DOLocalRotate_m2010640997(NULL /*static, unused*/, L_23, L_24, L_25, L_26, /*hidden argument*/NULL);
- V_6 = L_27;
- ObjectTranslator_t2020767555 * L_28 = V_0;
- intptr_t L_29 = ___L0;
- TweenerCore_3_t1299559007 * L_30 = V_6;
- NullCheck(L_28);
- ObjectTranslator_Push_m105918116(L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_008b:
- {
- int32_t L_31 = V_2;
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_0092:
- {
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- NullCheck(L_32);
- bool L_34 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_32, L_33, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_34)
- {
- goto IL_00de;
- }
- }
- IL_009f:
- {
- intptr_t L_35 = ___L0;
- int32_t L_36 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_35, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_36) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_00ac:
- {
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- NullCheck(L_37);
- ObjectTranslator_Get_m1627229423(L_37, L_38, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_39 = ___L0;
- double L_40 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_40)));
- Transform_t3600365921 * L_41 = V_1;
- Vector3_t3722313464 L_42 = V_8;
- float L_43 = V_9;
- TweenerCore_3_t1299559007 * L_44 = ShortcutExtensions_DOLocalRotate_m2010640997(NULL /*static, unused*/, L_41, L_42, L_43, 0, /*hidden argument*/NULL);
- V_10 = L_44;
- ObjectTranslator_t2020767555 * L_45 = V_0;
- intptr_t L_46 = ___L0;
- TweenerCore_3_t1299559007 * L_47 = V_10;
- NullCheck(L_45);
- ObjectTranslator_Push_m105918116(L_45, L_46, L_47, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_00de:
- {
- goto IL_00fe;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e3;
- throw e;
- }
- CATCH_00e3:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_48 = ___L0;
- Exception_t * L_49 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_50 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_49, /*hidden argument*/NULL);
- int32_t L_51 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_48, L_50, /*hidden argument*/NULL);
- V_7 = L_51;
- goto IL_010a;
- } // end catch (depth: 1)
- IL_00fe:
- {
- intptr_t L_52 = ___L0;
- int32_t L_53 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_52, _stringLiteral3178538062, /*hidden argument*/NULL);
- return L_53;
- }
- IL_010a:
- {
- int32_t L_54 = V_7;
- return L_54;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalRotateQuaternion(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalRotateQuaternion_m1557850094_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Quaternion_t2301928331 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- TweenerCore_3_t3785815898 * V_4 = NULL;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m3946340519(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- Transform_t3600365921 * L_10 = V_1;
- Quaternion_t2301928331 L_11 = V_2;
- float L_12 = V_3;
- TweenerCore_3_t3785815898 * L_13 = ShortcutExtensions_DOLocalRotateQuaternion_m3341936535(NULL /*static, unused*/, L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- TweenerCore_3_t3785815898 * L_16 = V_4;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_0063;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0048;
- throw e;
- }
- CATCH_0048:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- goto IL_0063;
- } // end catch (depth: 1)
- IL_0063:
- {
- int32_t L_21 = V_5;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScale_m1896281278 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOScale_m1896281278_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- TweenerCore_3_t2944330537 * V_5 = NULL;
- int32_t V_6 = 0;
- Vector3_t3722313464 V_7;
- memset(&V_7, 0, sizeof(V_7));
- float V_8 = 0.0f;
- TweenerCore_3_t2944330537 * V_9 = NULL;
- Exception_t * V_10 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)3))))
- {
- goto IL_0071;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_0071;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_0071;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- double L_14 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_13, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_14)));
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_16)));
- Transform_t3600365921 * L_17 = V_1;
- float L_18 = V_3;
- float L_19 = V_4;
- TweenerCore_3_t2944330537 * L_20 = ShortcutExtensions_DOScale_m3402774733(NULL /*static, unused*/, L_17, L_18, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- ObjectTranslator_t2020767555 * L_21 = V_0;
- intptr_t L_22 = ___L0;
- TweenerCore_3_t2944330537 * L_23 = V_5;
- NullCheck(L_21);
- ObjectTranslator_Push_m105918116(L_21, L_22, L_23, /*hidden argument*/NULL);
- V_6 = 1;
- goto IL_00ef;
- }
- IL_0071:
- {
- int32_t L_24 = V_2;
- if ((!(((uint32_t)L_24) == ((uint32_t)3))))
- {
- goto IL_00c3;
- }
- }
- IL_0078:
- {
- ObjectTranslator_t2020767555 * L_25 = V_0;
- intptr_t L_26 = ___L0;
- NullCheck(L_25);
- bool L_27 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_25, L_26, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_27)
- {
- goto IL_00c3;
- }
- }
- IL_0085:
- {
- intptr_t L_28 = ___L0;
- int32_t L_29 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_28, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_29) == ((uint32_t)3))))
- {
- goto IL_00c3;
- }
- }
- IL_0092:
- {
- ObjectTranslator_t2020767555 * L_30 = V_0;
- intptr_t L_31 = ___L0;
- NullCheck(L_30);
- ObjectTranslator_Get_m1627229423(L_30, L_31, 2, (&V_7), /*hidden argument*/NULL);
- intptr_t L_32 = ___L0;
- double L_33 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_32, 3, /*hidden argument*/NULL);
- V_8 = (((float)((float)L_33)));
- Transform_t3600365921 * L_34 = V_1;
- Vector3_t3722313464 L_35 = V_7;
- float L_36 = V_8;
- TweenerCore_3_t2944330537 * L_37 = ShortcutExtensions_DOScale_m495885115(NULL /*static, unused*/, L_34, L_35, L_36, /*hidden argument*/NULL);
- V_9 = L_37;
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- TweenerCore_3_t2944330537 * L_40 = V_9;
- NullCheck(L_38);
- ObjectTranslator_Push_m105918116(L_38, L_39, L_40, /*hidden argument*/NULL);
- V_6 = 1;
- goto IL_00ef;
- }
- IL_00c3:
- {
- goto IL_00e3;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00c8;
- throw e;
- }
- CATCH_00c8:
- { // begin catch(System.Exception)
- V_10 = ((Exception_t *)__exception_local);
- intptr_t L_41 = ___L0;
- Exception_t * L_42 = V_10;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_43 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_42, /*hidden argument*/NULL);
- int32_t L_44 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_41, L_43, /*hidden argument*/NULL);
- V_6 = L_44;
- goto IL_00ef;
- } // end catch (depth: 1)
- IL_00e3:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_45, _stringLiteral1033067621, /*hidden argument*/NULL);
- return L_46;
- }
- IL_00ef:
- {
- int32_t L_47 = V_6;
- return L_47;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScaleX(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScaleX_m2063790813 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOScaleX_m2063790813_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- float V_2 = 0.0f;
- float V_3 = 0.0f;
- TweenerCore_3_t2944330537 * V_4 = NULL;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- double L_7 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_7)));
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- Transform_t3600365921 * L_10 = V_1;
- float L_11 = V_2;
- float L_12 = V_3;
- TweenerCore_3_t2944330537 * L_13 = ShortcutExtensions_DOScaleX_m44278897(NULL /*static, unused*/, L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- TweenerCore_3_t2944330537 * L_16 = V_4;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_0062;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0047;
- throw e;
- }
- CATCH_0047:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- goto IL_0062;
- } // end catch (depth: 1)
- IL_0062:
- {
- int32_t L_21 = V_5;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScaleY(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScaleY_m3874994172 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOScaleY_m3874994172_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- float V_2 = 0.0f;
- float V_3 = 0.0f;
- TweenerCore_3_t2944330537 * V_4 = NULL;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- double L_7 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_7)));
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- Transform_t3600365921 * L_10 = V_1;
- float L_11 = V_2;
- float L_12 = V_3;
- TweenerCore_3_t2944330537 * L_13 = ShortcutExtensions_DOScaleY_m3341920956(NULL /*static, unused*/, L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- TweenerCore_3_t2944330537 * L_16 = V_4;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_0062;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0047;
- throw e;
- }
- CATCH_0047:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- goto IL_0062;
- } // end catch (depth: 1)
- IL_0062:
- {
- int32_t L_21 = V_5;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOScaleZ(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOScaleZ_m976566461 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOScaleZ_m976566461_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- float V_2 = 0.0f;
- float V_3 = 0.0f;
- TweenerCore_3_t2944330537 * V_4 = NULL;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- double L_7 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_7)));
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- Transform_t3600365921 * L_10 = V_1;
- float L_11 = V_2;
- float L_12 = V_3;
- TweenerCore_3_t2944330537 * L_13 = ShortcutExtensions_DOScaleZ_m3535152065(NULL /*static, unused*/, L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- TweenerCore_3_t2944330537 * L_16 = V_4;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_0062;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0047;
- throw e;
- }
- CATCH_0047:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- goto IL_0062;
- } // end catch (depth: 1)
- IL_0062:
- {
- int32_t L_21 = V_5;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLookAt(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLookAt_m89020156 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLookAt_m89020156_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- Nullable_1_t1149908250 V_6;
- memset(&V_6, 0, sizeof(V_6));
- Tweener_t436044680 * V_7 = NULL;
- int32_t V_8 = 0;
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- float V_10 = 0.0f;
- int32_t V_11 = 0;
- Tweener_t436044680 * V_12 = NULL;
- Nullable_1_t1149908250 V_13;
- memset(&V_13, 0, sizeof(V_13));
- Vector3_t3722313464 V_14;
- memset(&V_14, 0, sizeof(V_14));
- float V_15 = 0.0f;
- Tweener_t436044680 * V_16 = NULL;
- Exception_t * V_17 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)5))))
- {
- goto IL_00a4;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00a4;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00a4;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_00a4;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- NullCheck(L_17);
- bool L_19 = ObjectTranslator_Assignable_TisNullable_1_t1149908250_m1171964725(L_17, L_18, 5, /*hidden argument*/ObjectTranslator_Assignable_TisNullable_1_t1149908250_m1171964725_RuntimeMethod_var);
- if (!L_19)
- {
- goto IL_00a4;
- }
- }
- IL_005c:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- NullCheck(L_20);
- ObjectTranslator_Get_m1627229423(L_20, L_21, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- ObjectTranslator_t2020767555 * L_24 = V_0;
- intptr_t L_25 = ___L0;
- NullCheck(L_24);
- ObjectTranslator_Get_m3189878663(L_24, L_25, 4, (&V_5), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- NullCheck(L_26);
- ObjectTranslator_Get_TisNullable_1_t1149908250_m3400041693(L_26, L_27, 5, (&V_6), /*hidden argument*/ObjectTranslator_Get_TisNullable_1_t1149908250_m3400041693_RuntimeMethod_var);
- Transform_t3600365921 * L_28 = V_1;
- Vector3_t3722313464 L_29 = V_3;
- float L_30 = V_4;
- int32_t L_31 = V_5;
- Nullable_1_t1149908250 L_32 = V_6;
- Tweener_t436044680 * L_33 = ShortcutExtensions_DOLookAt_m735541971(NULL /*static, unused*/, L_28, L_29, L_30, L_31, L_32, /*hidden argument*/NULL);
- V_7 = L_33;
- ObjectTranslator_t2020767555 * L_34 = V_0;
- intptr_t L_35 = ___L0;
- Tweener_t436044680 * L_36 = V_7;
- NullCheck(L_34);
- ObjectTranslator_Push_m105918116(L_34, L_35, L_36, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_01a2;
- }
- IL_00a4:
- {
- int32_t L_37 = V_2;
- if ((!(((uint32_t)L_37) == ((uint32_t)4))))
- {
- goto IL_0119;
- }
- }
- IL_00ab:
- {
- ObjectTranslator_t2020767555 * L_38 = V_0;
- intptr_t L_39 = ___L0;
- NullCheck(L_38);
- bool L_40 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_38, L_39, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_40)
- {
- goto IL_0119;
- }
- }
- IL_00b8:
- {
- intptr_t L_41 = ___L0;
- int32_t L_42 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_41, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_42) == ((uint32_t)3))))
- {
- goto IL_0119;
- }
- }
- IL_00c5:
- {
- ObjectTranslator_t2020767555 * L_43 = V_0;
- intptr_t L_44 = ___L0;
- NullCheck(L_43);
- bool L_45 = ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570(L_43, L_44, 4, /*hidden argument*/ObjectTranslator_Assignable_TisAxisConstraint_t2771958344_m4141663570_RuntimeMethod_var);
- if (!L_45)
- {
- goto IL_0119;
- }
- }
- IL_00d2:
- {
- ObjectTranslator_t2020767555 * L_46 = V_0;
- intptr_t L_47 = ___L0;
- NullCheck(L_46);
- ObjectTranslator_Get_m1627229423(L_46, L_47, 2, (&V_9), /*hidden argument*/NULL);
- intptr_t L_48 = ___L0;
- double L_49 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_48, 3, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_49)));
- ObjectTranslator_t2020767555 * L_50 = V_0;
- intptr_t L_51 = ___L0;
- NullCheck(L_50);
- ObjectTranslator_Get_m3189878663(L_50, L_51, 4, (&V_11), /*hidden argument*/NULL);
- Transform_t3600365921 * L_52 = V_1;
- Vector3_t3722313464 L_53 = V_9;
- float L_54 = V_10;
- int32_t L_55 = V_11;
- il2cpp_codegen_initobj((&V_13), sizeof(Nullable_1_t1149908250 ));
- Nullable_1_t1149908250 L_56 = V_13;
- Tweener_t436044680 * L_57 = ShortcutExtensions_DOLookAt_m735541971(NULL /*static, unused*/, L_52, L_53, L_54, L_55, L_56, /*hidden argument*/NULL);
- V_12 = L_57;
- ObjectTranslator_t2020767555 * L_58 = V_0;
- intptr_t L_59 = ___L0;
- Tweener_t436044680 * L_60 = V_12;
- NullCheck(L_58);
- ObjectTranslator_Push_m105918116(L_58, L_59, L_60, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_01a2;
- }
- IL_0119:
- {
- int32_t L_61 = V_2;
- if ((!(((uint32_t)L_61) == ((uint32_t)3))))
- {
- goto IL_0176;
- }
- }
- IL_0120:
- {
- ObjectTranslator_t2020767555 * L_62 = V_0;
- intptr_t L_63 = ___L0;
- NullCheck(L_62);
- bool L_64 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_62, L_63, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_64)
- {
- goto IL_0176;
- }
- }
- IL_012d:
- {
- intptr_t L_65 = ___L0;
- int32_t L_66 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_65, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_66) == ((uint32_t)3))))
- {
- goto IL_0176;
- }
- }
- IL_013a:
- {
- ObjectTranslator_t2020767555 * L_67 = V_0;
- intptr_t L_68 = ___L0;
- NullCheck(L_67);
- ObjectTranslator_Get_m1627229423(L_67, L_68, 2, (&V_14), /*hidden argument*/NULL);
- intptr_t L_69 = ___L0;
- double L_70 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_69, 3, /*hidden argument*/NULL);
- V_15 = (((float)((float)L_70)));
- Transform_t3600365921 * L_71 = V_1;
- Vector3_t3722313464 L_72 = V_14;
- float L_73 = V_15;
- il2cpp_codegen_initobj((&V_13), sizeof(Nullable_1_t1149908250 ));
- Nullable_1_t1149908250 L_74 = V_13;
- Tweener_t436044680 * L_75 = ShortcutExtensions_DOLookAt_m735541971(NULL /*static, unused*/, L_71, L_72, L_73, 0, L_74, /*hidden argument*/NULL);
- V_16 = L_75;
- ObjectTranslator_t2020767555 * L_76 = V_0;
- intptr_t L_77 = ___L0;
- Tweener_t436044680 * L_78 = V_16;
- NullCheck(L_76);
- ObjectTranslator_Push_m105918116(L_76, L_77, L_78, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_01a2;
- }
- IL_0176:
- {
- goto IL_0196;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_017b;
- throw e;
- }
- CATCH_017b:
- { // begin catch(System.Exception)
- V_17 = ((Exception_t *)__exception_local);
- intptr_t L_79 = ___L0;
- Exception_t * L_80 = V_17;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_81 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_80, /*hidden argument*/NULL);
- int32_t L_82 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_79, L_81, /*hidden argument*/NULL);
- V_8 = L_82;
- goto IL_01a2;
- } // end catch (depth: 1)
- IL_0196:
- {
- intptr_t L_83 = ___L0;
- int32_t L_84 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_83, _stringLiteral4263630979, /*hidden argument*/NULL);
- return L_84;
- }
- IL_01a2:
- {
- int32_t L_85 = V_8;
- return L_85;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPunchPosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPunchPosition_m1266900073 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOPunchPosition_m1266900073_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- bool V_7 = false;
- Tweener_t436044680 * V_8 = NULL;
- int32_t V_9 = 0;
- Vector3_t3722313464 V_10;
- memset(&V_10, 0, sizeof(V_10));
- float V_11 = 0.0f;
- int32_t V_12 = 0;
- float V_13 = 0.0f;
- Tweener_t436044680 * V_14 = NULL;
- Vector3_t3722313464 V_15;
- memset(&V_15, 0, sizeof(V_15));
- float V_16 = 0.0f;
- int32_t V_17 = 0;
- Tweener_t436044680 * V_18 = NULL;
- Vector3_t3722313464 V_19;
- memset(&V_19, 0, sizeof(V_19));
- float V_20 = 0.0f;
- Tweener_t436044680 * V_21 = NULL;
- Exception_t * V_22 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)6))))
- {
- goto IL_00bb;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00bb;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_004f:
- {
- intptr_t L_16 = ___L0;
- int32_t L_17 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_16, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_17) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_005c:
- {
- intptr_t L_18 = ___L0;
- int32_t L_19 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_18, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_19) == ((uint32_t)1))))
- {
- goto IL_00bb;
- }
- }
- IL_0069:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- NullCheck(L_20);
- ObjectTranslator_Get_m1627229423(L_20, L_21, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- intptr_t L_24 = ___L0;
- int32_t L_25 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_24, 4, /*hidden argument*/NULL);
- V_5 = L_25;
- intptr_t L_26 = ___L0;
- double L_27 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_26, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_27)));
- intptr_t L_28 = ___L0;
- bool L_29 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_28, 6, /*hidden argument*/NULL);
- V_7 = L_29;
- Transform_t3600365921 * L_30 = V_1;
- Vector3_t3722313464 L_31 = V_3;
- float L_32 = V_4;
- int32_t L_33 = V_5;
- float L_34 = V_6;
- bool L_35 = V_7;
- Tweener_t436044680 * L_36 = ShortcutExtensions_DOPunchPosition_m2646086740(NULL /*static, unused*/, L_30, L_31, L_32, L_33, L_34, L_35, /*hidden argument*/NULL);
- V_8 = L_36;
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- Tweener_t436044680 * L_39 = V_8;
- NullCheck(L_37);
- ObjectTranslator_Push_m105918116(L_37, L_38, L_39, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0235;
- }
- IL_00bb:
- {
- int32_t L_40 = V_2;
- if ((!(((uint32_t)L_40) == ((uint32_t)5))))
- {
- goto IL_013f;
- }
- }
- IL_00c2:
- {
- ObjectTranslator_t2020767555 * L_41 = V_0;
- intptr_t L_42 = ___L0;
- NullCheck(L_41);
- bool L_43 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_41, L_42, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_43)
- {
- goto IL_013f;
- }
- }
- IL_00cf:
- {
- intptr_t L_44 = ___L0;
- int32_t L_45 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_44, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_45) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00dc:
- {
- intptr_t L_46 = ___L0;
- int32_t L_47 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_46, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_47) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00e9:
- {
- intptr_t L_48 = ___L0;
- int32_t L_49 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_48, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_49) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00f6:
- {
- ObjectTranslator_t2020767555 * L_50 = V_0;
- intptr_t L_51 = ___L0;
- NullCheck(L_50);
- ObjectTranslator_Get_m1627229423(L_50, L_51, 2, (&V_10), /*hidden argument*/NULL);
- intptr_t L_52 = ___L0;
- double L_53 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_52, 3, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_53)));
- intptr_t L_54 = ___L0;
- int32_t L_55 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_54, 4, /*hidden argument*/NULL);
- V_12 = L_55;
- intptr_t L_56 = ___L0;
- double L_57 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_56, 5, /*hidden argument*/NULL);
- V_13 = (((float)((float)L_57)));
- Transform_t3600365921 * L_58 = V_1;
- Vector3_t3722313464 L_59 = V_10;
- float L_60 = V_11;
- int32_t L_61 = V_12;
- float L_62 = V_13;
- Tweener_t436044680 * L_63 = ShortcutExtensions_DOPunchPosition_m2646086740(NULL /*static, unused*/, L_58, L_59, L_60, L_61, L_62, (bool)0, /*hidden argument*/NULL);
- V_14 = L_63;
- ObjectTranslator_t2020767555 * L_64 = V_0;
- intptr_t L_65 = ___L0;
- Tweener_t436044680 * L_66 = V_14;
- NullCheck(L_64);
- ObjectTranslator_Push_m105918116(L_64, L_65, L_66, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0235;
- }
- IL_013f:
- {
- int32_t L_67 = V_2;
- if ((!(((uint32_t)L_67) == ((uint32_t)4))))
- {
- goto IL_01af;
- }
- }
- IL_0146:
- {
- ObjectTranslator_t2020767555 * L_68 = V_0;
- intptr_t L_69 = ___L0;
- NullCheck(L_68);
- bool L_70 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_68, L_69, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_70)
- {
- goto IL_01af;
- }
- }
- IL_0153:
- {
- intptr_t L_71 = ___L0;
- int32_t L_72 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_71, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_72) == ((uint32_t)3))))
- {
- goto IL_01af;
- }
- }
- IL_0160:
- {
- intptr_t L_73 = ___L0;
- int32_t L_74 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_73, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_74) == ((uint32_t)3))))
- {
- goto IL_01af;
- }
- }
- IL_016d:
- {
- ObjectTranslator_t2020767555 * L_75 = V_0;
- intptr_t L_76 = ___L0;
- NullCheck(L_75);
- ObjectTranslator_Get_m1627229423(L_75, L_76, 2, (&V_15), /*hidden argument*/NULL);
- intptr_t L_77 = ___L0;
- double L_78 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_77, 3, /*hidden argument*/NULL);
- V_16 = (((float)((float)L_78)));
- intptr_t L_79 = ___L0;
- int32_t L_80 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_79, 4, /*hidden argument*/NULL);
- V_17 = L_80;
- Transform_t3600365921 * L_81 = V_1;
- Vector3_t3722313464 L_82 = V_15;
- float L_83 = V_16;
- int32_t L_84 = V_17;
- Tweener_t436044680 * L_85 = ShortcutExtensions_DOPunchPosition_m2646086740(NULL /*static, unused*/, L_81, L_82, L_83, L_84, (1.0f), (bool)0, /*hidden argument*/NULL);
- V_18 = L_85;
- ObjectTranslator_t2020767555 * L_86 = V_0;
- intptr_t L_87 = ___L0;
- Tweener_t436044680 * L_88 = V_18;
- NullCheck(L_86);
- ObjectTranslator_Push_m105918116(L_86, L_87, L_88, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0235;
- }
- IL_01af:
- {
- int32_t L_89 = V_2;
- if ((!(((uint32_t)L_89) == ((uint32_t)3))))
- {
- goto IL_0209;
- }
- }
- IL_01b6:
- {
- ObjectTranslator_t2020767555 * L_90 = V_0;
- intptr_t L_91 = ___L0;
- NullCheck(L_90);
- bool L_92 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_90, L_91, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_92)
- {
- goto IL_0209;
- }
- }
- IL_01c3:
- {
- intptr_t L_93 = ___L0;
- int32_t L_94 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_93, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_94) == ((uint32_t)3))))
- {
- goto IL_0209;
- }
- }
- IL_01d0:
- {
- ObjectTranslator_t2020767555 * L_95 = V_0;
- intptr_t L_96 = ___L0;
- NullCheck(L_95);
- ObjectTranslator_Get_m1627229423(L_95, L_96, 2, (&V_19), /*hidden argument*/NULL);
- intptr_t L_97 = ___L0;
- double L_98 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_97, 3, /*hidden argument*/NULL);
- V_20 = (((float)((float)L_98)));
- Transform_t3600365921 * L_99 = V_1;
- Vector3_t3722313464 L_100 = V_19;
- float L_101 = V_20;
- Tweener_t436044680 * L_102 = ShortcutExtensions_DOPunchPosition_m2646086740(NULL /*static, unused*/, L_99, L_100, L_101, ((int32_t)10), (1.0f), (bool)0, /*hidden argument*/NULL);
- V_21 = L_102;
- ObjectTranslator_t2020767555 * L_103 = V_0;
- intptr_t L_104 = ___L0;
- Tweener_t436044680 * L_105 = V_21;
- NullCheck(L_103);
- ObjectTranslator_Push_m105918116(L_103, L_104, L_105, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0235;
- }
- IL_0209:
- {
- goto IL_0229;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_020e;
- throw e;
- }
- CATCH_020e:
- { // begin catch(System.Exception)
- V_22 = ((Exception_t *)__exception_local);
- intptr_t L_106 = ___L0;
- Exception_t * L_107 = V_22;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_108 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_107, /*hidden argument*/NULL);
- int32_t L_109 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_106, L_108, /*hidden argument*/NULL);
- V_9 = L_109;
- goto IL_0235;
- } // end catch (depth: 1)
- IL_0229:
- {
- intptr_t L_110 = ___L0;
- int32_t L_111 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_110, _stringLiteral2339517550, /*hidden argument*/NULL);
- return L_111;
- }
- IL_0235:
- {
- int32_t L_112 = V_9;
- return L_112;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPunchScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPunchScale_m2535020043 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOPunchScale_m2535020043_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- Tweener_t436044680 * V_7 = NULL;
- int32_t V_8 = 0;
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- float V_10 = 0.0f;
- int32_t V_11 = 0;
- Tweener_t436044680 * V_12 = NULL;
- Vector3_t3722313464 V_13;
- memset(&V_13, 0, sizeof(V_13));
- float V_14 = 0.0f;
- Tweener_t436044680 * V_15 = NULL;
- Exception_t * V_16 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)5))))
- {
- goto IL_00a3;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00a3;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_004f:
- {
- intptr_t L_16 = ___L0;
- int32_t L_17 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_16, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_17) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_005c:
- {
- ObjectTranslator_t2020767555 * L_18 = V_0;
- intptr_t L_19 = ___L0;
- NullCheck(L_18);
- ObjectTranslator_Get_m1627229423(L_18, L_19, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_20 = ___L0;
- double L_21 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_20, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_21)));
- intptr_t L_22 = ___L0;
- int32_t L_23 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_22, 4, /*hidden argument*/NULL);
- V_5 = L_23;
- intptr_t L_24 = ___L0;
- double L_25 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_24, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_25)));
- Transform_t3600365921 * L_26 = V_1;
- Vector3_t3722313464 L_27 = V_3;
- float L_28 = V_4;
- int32_t L_29 = V_5;
- float L_30 = V_6;
- Tweener_t436044680 * L_31 = ShortcutExtensions_DOPunchScale_m4912217(NULL /*static, unused*/, L_26, L_27, L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = L_31;
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- Tweener_t436044680 * L_34 = V_7;
- NullCheck(L_32);
- ObjectTranslator_Push_m105918116(L_32, L_33, L_34, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_00a3:
- {
- int32_t L_35 = V_2;
- if ((!(((uint32_t)L_35) == ((uint32_t)4))))
- {
- goto IL_0112;
- }
- }
- IL_00aa:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- bool L_38 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_36, L_37, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_38)
- {
- goto IL_0112;
- }
- }
- IL_00b7:
- {
- intptr_t L_39 = ___L0;
- int32_t L_40 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_40) == ((uint32_t)3))))
- {
- goto IL_0112;
- }
- }
- IL_00c4:
- {
- intptr_t L_41 = ___L0;
- int32_t L_42 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_41, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_42) == ((uint32_t)3))))
- {
- goto IL_0112;
- }
- }
- IL_00d1:
- {
- ObjectTranslator_t2020767555 * L_43 = V_0;
- intptr_t L_44 = ___L0;
- NullCheck(L_43);
- ObjectTranslator_Get_m1627229423(L_43, L_44, 2, (&V_9), /*hidden argument*/NULL);
- intptr_t L_45 = ___L0;
- double L_46 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_45, 3, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_46)));
- intptr_t L_47 = ___L0;
- int32_t L_48 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_47, 4, /*hidden argument*/NULL);
- V_11 = L_48;
- Transform_t3600365921 * L_49 = V_1;
- Vector3_t3722313464 L_50 = V_9;
- float L_51 = V_10;
- int32_t L_52 = V_11;
- Tweener_t436044680 * L_53 = ShortcutExtensions_DOPunchScale_m4912217(NULL /*static, unused*/, L_49, L_50, L_51, L_52, (1.0f), /*hidden argument*/NULL);
- V_12 = L_53;
- ObjectTranslator_t2020767555 * L_54 = V_0;
- intptr_t L_55 = ___L0;
- Tweener_t436044680 * L_56 = V_12;
- NullCheck(L_54);
- ObjectTranslator_Push_m105918116(L_54, L_55, L_56, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_0112:
- {
- int32_t L_57 = V_2;
- if ((!(((uint32_t)L_57) == ((uint32_t)3))))
- {
- goto IL_016b;
- }
- }
- IL_0119:
- {
- ObjectTranslator_t2020767555 * L_58 = V_0;
- intptr_t L_59 = ___L0;
- NullCheck(L_58);
- bool L_60 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_58, L_59, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_60)
- {
- goto IL_016b;
- }
- }
- IL_0126:
- {
- intptr_t L_61 = ___L0;
- int32_t L_62 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_61, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_62) == ((uint32_t)3))))
- {
- goto IL_016b;
- }
- }
- IL_0133:
- {
- ObjectTranslator_t2020767555 * L_63 = V_0;
- intptr_t L_64 = ___L0;
- NullCheck(L_63);
- ObjectTranslator_Get_m1627229423(L_63, L_64, 2, (&V_13), /*hidden argument*/NULL);
- intptr_t L_65 = ___L0;
- double L_66 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_65, 3, /*hidden argument*/NULL);
- V_14 = (((float)((float)L_66)));
- Transform_t3600365921 * L_67 = V_1;
- Vector3_t3722313464 L_68 = V_13;
- float L_69 = V_14;
- Tweener_t436044680 * L_70 = ShortcutExtensions_DOPunchScale_m4912217(NULL /*static, unused*/, L_67, L_68, L_69, ((int32_t)10), (1.0f), /*hidden argument*/NULL);
- V_15 = L_70;
- ObjectTranslator_t2020767555 * L_71 = V_0;
- intptr_t L_72 = ___L0;
- Tweener_t436044680 * L_73 = V_15;
- NullCheck(L_71);
- ObjectTranslator_Push_m105918116(L_71, L_72, L_73, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_016b:
- {
- goto IL_018b;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0170;
- throw e;
- }
- CATCH_0170:
- { // begin catch(System.Exception)
- V_16 = ((Exception_t *)__exception_local);
- intptr_t L_74 = ___L0;
- Exception_t * L_75 = V_16;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_76 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_75, /*hidden argument*/NULL);
- int32_t L_77 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_74, L_76, /*hidden argument*/NULL);
- V_8 = L_77;
- goto IL_0197;
- } // end catch (depth: 1)
- IL_018b:
- {
- intptr_t L_78 = ___L0;
- int32_t L_79 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_78, _stringLiteral912903002, /*hidden argument*/NULL);
- return L_79;
- }
- IL_0197:
- {
- int32_t L_80 = V_8;
- return L_80;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPunchRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPunchRotation_m3158922004 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOPunchRotation_m3158922004_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- Tweener_t436044680 * V_7 = NULL;
- int32_t V_8 = 0;
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- float V_10 = 0.0f;
- int32_t V_11 = 0;
- Tweener_t436044680 * V_12 = NULL;
- Vector3_t3722313464 V_13;
- memset(&V_13, 0, sizeof(V_13));
- float V_14 = 0.0f;
- Tweener_t436044680 * V_15 = NULL;
- Exception_t * V_16 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)5))))
- {
- goto IL_00a3;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00a3;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_004f:
- {
- intptr_t L_16 = ___L0;
- int32_t L_17 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_16, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_17) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_005c:
- {
- ObjectTranslator_t2020767555 * L_18 = V_0;
- intptr_t L_19 = ___L0;
- NullCheck(L_18);
- ObjectTranslator_Get_m1627229423(L_18, L_19, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_20 = ___L0;
- double L_21 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_20, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_21)));
- intptr_t L_22 = ___L0;
- int32_t L_23 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_22, 4, /*hidden argument*/NULL);
- V_5 = L_23;
- intptr_t L_24 = ___L0;
- double L_25 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_24, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_25)));
- Transform_t3600365921 * L_26 = V_1;
- Vector3_t3722313464 L_27 = V_3;
- float L_28 = V_4;
- int32_t L_29 = V_5;
- float L_30 = V_6;
- Tweener_t436044680 * L_31 = ShortcutExtensions_DOPunchRotation_m3077511679(NULL /*static, unused*/, L_26, L_27, L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = L_31;
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- Tweener_t436044680 * L_34 = V_7;
- NullCheck(L_32);
- ObjectTranslator_Push_m105918116(L_32, L_33, L_34, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_00a3:
- {
- int32_t L_35 = V_2;
- if ((!(((uint32_t)L_35) == ((uint32_t)4))))
- {
- goto IL_0112;
- }
- }
- IL_00aa:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- bool L_38 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_36, L_37, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_38)
- {
- goto IL_0112;
- }
- }
- IL_00b7:
- {
- intptr_t L_39 = ___L0;
- int32_t L_40 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_40) == ((uint32_t)3))))
- {
- goto IL_0112;
- }
- }
- IL_00c4:
- {
- intptr_t L_41 = ___L0;
- int32_t L_42 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_41, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_42) == ((uint32_t)3))))
- {
- goto IL_0112;
- }
- }
- IL_00d1:
- {
- ObjectTranslator_t2020767555 * L_43 = V_0;
- intptr_t L_44 = ___L0;
- NullCheck(L_43);
- ObjectTranslator_Get_m1627229423(L_43, L_44, 2, (&V_9), /*hidden argument*/NULL);
- intptr_t L_45 = ___L0;
- double L_46 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_45, 3, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_46)));
- intptr_t L_47 = ___L0;
- int32_t L_48 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_47, 4, /*hidden argument*/NULL);
- V_11 = L_48;
- Transform_t3600365921 * L_49 = V_1;
- Vector3_t3722313464 L_50 = V_9;
- float L_51 = V_10;
- int32_t L_52 = V_11;
- Tweener_t436044680 * L_53 = ShortcutExtensions_DOPunchRotation_m3077511679(NULL /*static, unused*/, L_49, L_50, L_51, L_52, (1.0f), /*hidden argument*/NULL);
- V_12 = L_53;
- ObjectTranslator_t2020767555 * L_54 = V_0;
- intptr_t L_55 = ___L0;
- Tweener_t436044680 * L_56 = V_12;
- NullCheck(L_54);
- ObjectTranslator_Push_m105918116(L_54, L_55, L_56, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_0112:
- {
- int32_t L_57 = V_2;
- if ((!(((uint32_t)L_57) == ((uint32_t)3))))
- {
- goto IL_016b;
- }
- }
- IL_0119:
- {
- ObjectTranslator_t2020767555 * L_58 = V_0;
- intptr_t L_59 = ___L0;
- NullCheck(L_58);
- bool L_60 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_58, L_59, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_60)
- {
- goto IL_016b;
- }
- }
- IL_0126:
- {
- intptr_t L_61 = ___L0;
- int32_t L_62 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_61, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_62) == ((uint32_t)3))))
- {
- goto IL_016b;
- }
- }
- IL_0133:
- {
- ObjectTranslator_t2020767555 * L_63 = V_0;
- intptr_t L_64 = ___L0;
- NullCheck(L_63);
- ObjectTranslator_Get_m1627229423(L_63, L_64, 2, (&V_13), /*hidden argument*/NULL);
- intptr_t L_65 = ___L0;
- double L_66 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_65, 3, /*hidden argument*/NULL);
- V_14 = (((float)((float)L_66)));
- Transform_t3600365921 * L_67 = V_1;
- Vector3_t3722313464 L_68 = V_13;
- float L_69 = V_14;
- Tweener_t436044680 * L_70 = ShortcutExtensions_DOPunchRotation_m3077511679(NULL /*static, unused*/, L_67, L_68, L_69, ((int32_t)10), (1.0f), /*hidden argument*/NULL);
- V_15 = L_70;
- ObjectTranslator_t2020767555 * L_71 = V_0;
- intptr_t L_72 = ___L0;
- Tweener_t436044680 * L_73 = V_15;
- NullCheck(L_71);
- ObjectTranslator_Push_m105918116(L_71, L_72, L_73, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_016b:
- {
- goto IL_018b;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0170;
- throw e;
- }
- CATCH_0170:
- { // begin catch(System.Exception)
- V_16 = ((Exception_t *)__exception_local);
- intptr_t L_74 = ___L0;
- Exception_t * L_75 = V_16;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_76 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_75, /*hidden argument*/NULL);
- int32_t L_77 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_74, L_76, /*hidden argument*/NULL);
- V_8 = L_77;
- goto IL_0197;
- } // end catch (depth: 1)
- IL_018b:
- {
- intptr_t L_78 = ___L0;
- int32_t L_79 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_78, _stringLiteral3969395025, /*hidden argument*/NULL);
- return L_79;
- }
- IL_0197:
- {
- int32_t L_80 = V_8;
- return L_80;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOShakePosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOShakePosition_m3720856662 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOShakePosition_m3720856662_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- bool V_7 = false;
- bool V_8 = false;
- Tweener_t436044680 * V_9 = NULL;
- int32_t V_10 = 0;
- float V_11 = 0.0f;
- float V_12 = 0.0f;
- int32_t V_13 = 0;
- float V_14 = 0.0f;
- bool V_15 = false;
- Tweener_t436044680 * V_16 = NULL;
- float V_17 = 0.0f;
- float V_18 = 0.0f;
- int32_t V_19 = 0;
- float V_20 = 0.0f;
- Tweener_t436044680 * V_21 = NULL;
- float V_22 = 0.0f;
- float V_23 = 0.0f;
- int32_t V_24 = 0;
- Tweener_t436044680 * V_25 = NULL;
- float V_26 = 0.0f;
- float V_27 = 0.0f;
- Tweener_t436044680 * V_28 = NULL;
- float V_29 = 0.0f;
- Tweener_t436044680 * V_30 = NULL;
- float V_31 = 0.0f;
- Vector3_t3722313464 V_32;
- memset(&V_32, 0, sizeof(V_32));
- int32_t V_33 = 0;
- float V_34 = 0.0f;
- bool V_35 = false;
- bool V_36 = false;
- Tweener_t436044680 * V_37 = NULL;
- float V_38 = 0.0f;
- Vector3_t3722313464 V_39;
- memset(&V_39, 0, sizeof(V_39));
- int32_t V_40 = 0;
- float V_41 = 0.0f;
- bool V_42 = false;
- Tweener_t436044680 * V_43 = NULL;
- float V_44 = 0.0f;
- Vector3_t3722313464 V_45;
- memset(&V_45, 0, sizeof(V_45));
- int32_t V_46 = 0;
- float V_47 = 0.0f;
- Tweener_t436044680 * V_48 = NULL;
- float V_49 = 0.0f;
- Vector3_t3722313464 V_50;
- memset(&V_50, 0, sizeof(V_50));
- int32_t V_51 = 0;
- Tweener_t436044680 * V_52 = NULL;
- float V_53 = 0.0f;
- Vector3_t3722313464 V_54;
- memset(&V_54, 0, sizeof(V_54));
- Tweener_t436044680 * V_55 = NULL;
- Exception_t * V_56 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)7))))
- {
- goto IL_00d2;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_00d2;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_00d2;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_00d2;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- int32_t L_16 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_15, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_16) == ((uint32_t)3))))
- {
- goto IL_00d2;
- }
- }
- IL_005c:
- {
- intptr_t L_17 = ___L0;
- int32_t L_18 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_17, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_18) == ((uint32_t)1))))
- {
- goto IL_00d2;
- }
- }
- IL_0069:
- {
- intptr_t L_19 = ___L0;
- int32_t L_20 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_19, 7, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_20) == ((uint32_t)1))))
- {
- goto IL_00d2;
- }
- }
- IL_0076:
- {
- intptr_t L_21 = ___L0;
- double L_22 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_21, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_22)));
- intptr_t L_23 = ___L0;
- double L_24 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_23, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_24)));
- intptr_t L_25 = ___L0;
- int32_t L_26 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_25, 4, /*hidden argument*/NULL);
- V_5 = L_26;
- intptr_t L_27 = ___L0;
- double L_28 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_27, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_28)));
- intptr_t L_29 = ___L0;
- bool L_30 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_29, 6, /*hidden argument*/NULL);
- V_7 = L_30;
- intptr_t L_31 = ___L0;
- bool L_32 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_31, 7, /*hidden argument*/NULL);
- V_8 = L_32;
- Transform_t3600365921 * L_33 = V_1;
- float L_34 = V_3;
- float L_35 = V_4;
- int32_t L_36 = V_5;
- float L_37 = V_6;
- bool L_38 = V_7;
- bool L_39 = V_8;
- Tweener_t436044680 * L_40 = ShortcutExtensions_DOShakePosition_m1859704350(NULL /*static, unused*/, L_33, L_34, L_35, L_36, L_37, L_38, L_39, /*hidden argument*/NULL);
- V_9 = L_40;
- ObjectTranslator_t2020767555 * L_41 = V_0;
- intptr_t L_42 = ___L0;
- Tweener_t436044680 * L_43 = V_9;
- NullCheck(L_41);
- ObjectTranslator_Push_m105918116(L_41, L_42, L_43, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_00d2:
- {
- int32_t L_44 = V_2;
- if ((!(((uint32_t)L_44) == ((uint32_t)6))))
- {
- goto IL_016e;
- }
- }
- IL_00d9:
- {
- intptr_t L_45 = ___L0;
- int32_t L_46 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_45, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_46) == ((uint32_t)3))))
- {
- goto IL_016e;
- }
- }
- IL_00e6:
- {
- intptr_t L_47 = ___L0;
- int32_t L_48 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_47, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_48) == ((uint32_t)3))))
- {
- goto IL_016e;
- }
- }
- IL_00f3:
- {
- intptr_t L_49 = ___L0;
- int32_t L_50 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_49, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_50) == ((uint32_t)3))))
- {
- goto IL_016e;
- }
- }
- IL_0100:
- {
- intptr_t L_51 = ___L0;
- int32_t L_52 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_51, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_52) == ((uint32_t)3))))
- {
- goto IL_016e;
- }
- }
- IL_010d:
- {
- intptr_t L_53 = ___L0;
- int32_t L_54 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_53, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_54) == ((uint32_t)1))))
- {
- goto IL_016e;
- }
- }
- IL_011a:
- {
- intptr_t L_55 = ___L0;
- double L_56 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_55, 2, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_56)));
- intptr_t L_57 = ___L0;
- double L_58 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_57, 3, /*hidden argument*/NULL);
- V_12 = (((float)((float)L_58)));
- intptr_t L_59 = ___L0;
- int32_t L_60 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_59, 4, /*hidden argument*/NULL);
- V_13 = L_60;
- intptr_t L_61 = ___L0;
- double L_62 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_61, 5, /*hidden argument*/NULL);
- V_14 = (((float)((float)L_62)));
- intptr_t L_63 = ___L0;
- bool L_64 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_63, 6, /*hidden argument*/NULL);
- V_15 = L_64;
- Transform_t3600365921 * L_65 = V_1;
- float L_66 = V_11;
- float L_67 = V_12;
- int32_t L_68 = V_13;
- float L_69 = V_14;
- bool L_70 = V_15;
- Tweener_t436044680 * L_71 = ShortcutExtensions_DOShakePosition_m1859704350(NULL /*static, unused*/, L_65, L_66, L_67, L_68, L_69, L_70, (bool)1, /*hidden argument*/NULL);
- V_16 = L_71;
- ObjectTranslator_t2020767555 * L_72 = V_0;
- intptr_t L_73 = ___L0;
- Tweener_t436044680 * L_74 = V_16;
- NullCheck(L_72);
- ObjectTranslator_Push_m105918116(L_72, L_73, L_74, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_016e:
- {
- int32_t L_75 = V_2;
- if ((!(((uint32_t)L_75) == ((uint32_t)5))))
- {
- goto IL_01f3;
- }
- }
- IL_0175:
- {
- intptr_t L_76 = ___L0;
- int32_t L_77 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_76, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_77) == ((uint32_t)3))))
- {
- goto IL_01f3;
- }
- }
- IL_0182:
- {
- intptr_t L_78 = ___L0;
- int32_t L_79 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_78, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_79) == ((uint32_t)3))))
- {
- goto IL_01f3;
- }
- }
- IL_018f:
- {
- intptr_t L_80 = ___L0;
- int32_t L_81 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_80, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_81) == ((uint32_t)3))))
- {
- goto IL_01f3;
- }
- }
- IL_019c:
- {
- intptr_t L_82 = ___L0;
- int32_t L_83 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_82, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_83) == ((uint32_t)3))))
- {
- goto IL_01f3;
- }
- }
- IL_01a9:
- {
- intptr_t L_84 = ___L0;
- double L_85 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_84, 2, /*hidden argument*/NULL);
- V_17 = (((float)((float)L_85)));
- intptr_t L_86 = ___L0;
- double L_87 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_86, 3, /*hidden argument*/NULL);
- V_18 = (((float)((float)L_87)));
- intptr_t L_88 = ___L0;
- int32_t L_89 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_88, 4, /*hidden argument*/NULL);
- V_19 = L_89;
- intptr_t L_90 = ___L0;
- double L_91 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_90, 5, /*hidden argument*/NULL);
- V_20 = (((float)((float)L_91)));
- Transform_t3600365921 * L_92 = V_1;
- float L_93 = V_17;
- float L_94 = V_18;
- int32_t L_95 = V_19;
- float L_96 = V_20;
- Tweener_t436044680 * L_97 = ShortcutExtensions_DOShakePosition_m1859704350(NULL /*static, unused*/, L_92, L_93, L_94, L_95, L_96, (bool)0, (bool)1, /*hidden argument*/NULL);
- V_21 = L_97;
- ObjectTranslator_t2020767555 * L_98 = V_0;
- intptr_t L_99 = ___L0;
- Tweener_t436044680 * L_100 = V_21;
- NullCheck(L_98);
- ObjectTranslator_Push_m105918116(L_98, L_99, L_100, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_01f3:
- {
- int32_t L_101 = V_2;
- if ((!(((uint32_t)L_101) == ((uint32_t)4))))
- {
- goto IL_0264;
- }
- }
- IL_01fa:
- {
- intptr_t L_102 = ___L0;
- int32_t L_103 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_102, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_103) == ((uint32_t)3))))
- {
- goto IL_0264;
- }
- }
- IL_0207:
- {
- intptr_t L_104 = ___L0;
- int32_t L_105 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_104, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_105) == ((uint32_t)3))))
- {
- goto IL_0264;
- }
- }
- IL_0214:
- {
- intptr_t L_106 = ___L0;
- int32_t L_107 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_106, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_107) == ((uint32_t)3))))
- {
- goto IL_0264;
- }
- }
- IL_0221:
- {
- intptr_t L_108 = ___L0;
- double L_109 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_108, 2, /*hidden argument*/NULL);
- V_22 = (((float)((float)L_109)));
- intptr_t L_110 = ___L0;
- double L_111 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_110, 3, /*hidden argument*/NULL);
- V_23 = (((float)((float)L_111)));
- intptr_t L_112 = ___L0;
- int32_t L_113 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_112, 4, /*hidden argument*/NULL);
- V_24 = L_113;
- Transform_t3600365921 * L_114 = V_1;
- float L_115 = V_22;
- float L_116 = V_23;
- int32_t L_117 = V_24;
- Tweener_t436044680 * L_118 = ShortcutExtensions_DOShakePosition_m1859704350(NULL /*static, unused*/, L_114, L_115, L_116, L_117, (90.0f), (bool)0, (bool)1, /*hidden argument*/NULL);
- V_25 = L_118;
- ObjectTranslator_t2020767555 * L_119 = V_0;
- intptr_t L_120 = ___L0;
- Tweener_t436044680 * L_121 = V_25;
- NullCheck(L_119);
- ObjectTranslator_Push_m105918116(L_119, L_120, L_121, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_0264:
- {
- int32_t L_122 = V_2;
- if ((!(((uint32_t)L_122) == ((uint32_t)3))))
- {
- goto IL_02bf;
- }
- }
- IL_026b:
- {
- intptr_t L_123 = ___L0;
- int32_t L_124 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_123, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_124) == ((uint32_t)3))))
- {
- goto IL_02bf;
- }
- }
- IL_0278:
- {
- intptr_t L_125 = ___L0;
- int32_t L_126 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_125, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_126) == ((uint32_t)3))))
- {
- goto IL_02bf;
- }
- }
- IL_0285:
- {
- intptr_t L_127 = ___L0;
- double L_128 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_127, 2, /*hidden argument*/NULL);
- V_26 = (((float)((float)L_128)));
- intptr_t L_129 = ___L0;
- double L_130 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_129, 3, /*hidden argument*/NULL);
- V_27 = (((float)((float)L_130)));
- Transform_t3600365921 * L_131 = V_1;
- float L_132 = V_26;
- float L_133 = V_27;
- Tweener_t436044680 * L_134 = ShortcutExtensions_DOShakePosition_m1859704350(NULL /*static, unused*/, L_131, L_132, L_133, ((int32_t)10), (90.0f), (bool)0, (bool)1, /*hidden argument*/NULL);
- V_28 = L_134;
- ObjectTranslator_t2020767555 * L_135 = V_0;
- intptr_t L_136 = ___L0;
- Tweener_t436044680 * L_137 = V_28;
- NullCheck(L_135);
- ObjectTranslator_Push_m105918116(L_135, L_136, L_137, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_02bf:
- {
- int32_t L_138 = V_2;
- if ((!(((uint32_t)L_138) == ((uint32_t)2))))
- {
- goto IL_0306;
- }
- }
- IL_02c6:
- {
- intptr_t L_139 = ___L0;
- int32_t L_140 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_139, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_140) == ((uint32_t)3))))
- {
- goto IL_0306;
- }
- }
- IL_02d3:
- {
- intptr_t L_141 = ___L0;
- double L_142 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_141, 2, /*hidden argument*/NULL);
- V_29 = (((float)((float)L_142)));
- Transform_t3600365921 * L_143 = V_1;
- float L_144 = V_29;
- Tweener_t436044680 * L_145 = ShortcutExtensions_DOShakePosition_m1859704350(NULL /*static, unused*/, L_143, L_144, (1.0f), ((int32_t)10), (90.0f), (bool)0, (bool)1, /*hidden argument*/NULL);
- V_30 = L_145;
- ObjectTranslator_t2020767555 * L_146 = V_0;
- intptr_t L_147 = ___L0;
- Tweener_t436044680 * L_148 = V_30;
- NullCheck(L_146);
- ObjectTranslator_Push_m105918116(L_146, L_147, L_148, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_0306:
- {
- int32_t L_149 = V_2;
- if ((!(((uint32_t)L_149) == ((uint32_t)7))))
- {
- goto IL_03b9;
- }
- }
- IL_030d:
- {
- intptr_t L_150 = ___L0;
- int32_t L_151 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_150, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_151) == ((uint32_t)3))))
- {
- goto IL_03b9;
- }
- }
- IL_031a:
- {
- ObjectTranslator_t2020767555 * L_152 = V_0;
- intptr_t L_153 = ___L0;
- NullCheck(L_152);
- bool L_154 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_152, L_153, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_154)
- {
- goto IL_03b9;
- }
- }
- IL_0327:
- {
- intptr_t L_155 = ___L0;
- int32_t L_156 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_155, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_156) == ((uint32_t)3))))
- {
- goto IL_03b9;
- }
- }
- IL_0334:
- {
- intptr_t L_157 = ___L0;
- int32_t L_158 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_157, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_158) == ((uint32_t)3))))
- {
- goto IL_03b9;
- }
- }
- IL_0341:
- {
- intptr_t L_159 = ___L0;
- int32_t L_160 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_159, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_160) == ((uint32_t)1))))
- {
- goto IL_03b9;
- }
- }
- IL_034e:
- {
- intptr_t L_161 = ___L0;
- int32_t L_162 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_161, 7, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_162) == ((uint32_t)1))))
- {
- goto IL_03b9;
- }
- }
- IL_035b:
- {
- intptr_t L_163 = ___L0;
- double L_164 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_163, 2, /*hidden argument*/NULL);
- V_31 = (((float)((float)L_164)));
- ObjectTranslator_t2020767555 * L_165 = V_0;
- intptr_t L_166 = ___L0;
- NullCheck(L_165);
- ObjectTranslator_Get_m1627229423(L_165, L_166, 3, (&V_32), /*hidden argument*/NULL);
- intptr_t L_167 = ___L0;
- int32_t L_168 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_167, 4, /*hidden argument*/NULL);
- V_33 = L_168;
- intptr_t L_169 = ___L0;
- double L_170 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_169, 5, /*hidden argument*/NULL);
- V_34 = (((float)((float)L_170)));
- intptr_t L_171 = ___L0;
- bool L_172 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_171, 6, /*hidden argument*/NULL);
- V_35 = L_172;
- intptr_t L_173 = ___L0;
- bool L_174 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_173, 7, /*hidden argument*/NULL);
- V_36 = L_174;
- Transform_t3600365921 * L_175 = V_1;
- float L_176 = V_31;
- Vector3_t3722313464 L_177 = V_32;
- int32_t L_178 = V_33;
- float L_179 = V_34;
- bool L_180 = V_35;
- bool L_181 = V_36;
- Tweener_t436044680 * L_182 = ShortcutExtensions_DOShakePosition_m3797325453(NULL /*static, unused*/, L_175, L_176, L_177, L_178, L_179, L_180, L_181, /*hidden argument*/NULL);
- V_37 = L_182;
- ObjectTranslator_t2020767555 * L_183 = V_0;
- intptr_t L_184 = ___L0;
- Tweener_t436044680 * L_185 = V_37;
- NullCheck(L_183);
- ObjectTranslator_Push_m105918116(L_183, L_184, L_185, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_03b9:
- {
- int32_t L_186 = V_2;
- if ((!(((uint32_t)L_186) == ((uint32_t)6))))
- {
- goto IL_0455;
- }
- }
- IL_03c0:
- {
- intptr_t L_187 = ___L0;
- int32_t L_188 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_187, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_188) == ((uint32_t)3))))
- {
- goto IL_0455;
- }
- }
- IL_03cd:
- {
- ObjectTranslator_t2020767555 * L_189 = V_0;
- intptr_t L_190 = ___L0;
- NullCheck(L_189);
- bool L_191 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_189, L_190, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_191)
- {
- goto IL_0455;
- }
- }
- IL_03da:
- {
- intptr_t L_192 = ___L0;
- int32_t L_193 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_192, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_193) == ((uint32_t)3))))
- {
- goto IL_0455;
- }
- }
- IL_03e7:
- {
- intptr_t L_194 = ___L0;
- int32_t L_195 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_194, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_195) == ((uint32_t)3))))
- {
- goto IL_0455;
- }
- }
- IL_03f4:
- {
- intptr_t L_196 = ___L0;
- int32_t L_197 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_196, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_197) == ((uint32_t)1))))
- {
- goto IL_0455;
- }
- }
- IL_0401:
- {
- intptr_t L_198 = ___L0;
- double L_199 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_198, 2, /*hidden argument*/NULL);
- V_38 = (((float)((float)L_199)));
- ObjectTranslator_t2020767555 * L_200 = V_0;
- intptr_t L_201 = ___L0;
- NullCheck(L_200);
- ObjectTranslator_Get_m1627229423(L_200, L_201, 3, (&V_39), /*hidden argument*/NULL);
- intptr_t L_202 = ___L0;
- int32_t L_203 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_202, 4, /*hidden argument*/NULL);
- V_40 = L_203;
- intptr_t L_204 = ___L0;
- double L_205 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_204, 5, /*hidden argument*/NULL);
- V_41 = (((float)((float)L_205)));
- intptr_t L_206 = ___L0;
- bool L_207 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_206, 6, /*hidden argument*/NULL);
- V_42 = L_207;
- Transform_t3600365921 * L_208 = V_1;
- float L_209 = V_38;
- Vector3_t3722313464 L_210 = V_39;
- int32_t L_211 = V_40;
- float L_212 = V_41;
- bool L_213 = V_42;
- Tweener_t436044680 * L_214 = ShortcutExtensions_DOShakePosition_m3797325453(NULL /*static, unused*/, L_208, L_209, L_210, L_211, L_212, L_213, (bool)1, /*hidden argument*/NULL);
- V_43 = L_214;
- ObjectTranslator_t2020767555 * L_215 = V_0;
- intptr_t L_216 = ___L0;
- Tweener_t436044680 * L_217 = V_43;
- NullCheck(L_215);
- ObjectTranslator_Push_m105918116(L_215, L_216, L_217, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_0455:
- {
- int32_t L_218 = V_2;
- if ((!(((uint32_t)L_218) == ((uint32_t)5))))
- {
- goto IL_04da;
- }
- }
- IL_045c:
- {
- intptr_t L_219 = ___L0;
- int32_t L_220 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_219, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_220) == ((uint32_t)3))))
- {
- goto IL_04da;
- }
- }
- IL_0469:
- {
- ObjectTranslator_t2020767555 * L_221 = V_0;
- intptr_t L_222 = ___L0;
- NullCheck(L_221);
- bool L_223 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_221, L_222, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_223)
- {
- goto IL_04da;
- }
- }
- IL_0476:
- {
- intptr_t L_224 = ___L0;
- int32_t L_225 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_224, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_225) == ((uint32_t)3))))
- {
- goto IL_04da;
- }
- }
- IL_0483:
- {
- intptr_t L_226 = ___L0;
- int32_t L_227 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_226, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_227) == ((uint32_t)3))))
- {
- goto IL_04da;
- }
- }
- IL_0490:
- {
- intptr_t L_228 = ___L0;
- double L_229 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_228, 2, /*hidden argument*/NULL);
- V_44 = (((float)((float)L_229)));
- ObjectTranslator_t2020767555 * L_230 = V_0;
- intptr_t L_231 = ___L0;
- NullCheck(L_230);
- ObjectTranslator_Get_m1627229423(L_230, L_231, 3, (&V_45), /*hidden argument*/NULL);
- intptr_t L_232 = ___L0;
- int32_t L_233 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_232, 4, /*hidden argument*/NULL);
- V_46 = L_233;
- intptr_t L_234 = ___L0;
- double L_235 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_234, 5, /*hidden argument*/NULL);
- V_47 = (((float)((float)L_235)));
- Transform_t3600365921 * L_236 = V_1;
- float L_237 = V_44;
- Vector3_t3722313464 L_238 = V_45;
- int32_t L_239 = V_46;
- float L_240 = V_47;
- Tweener_t436044680 * L_241 = ShortcutExtensions_DOShakePosition_m3797325453(NULL /*static, unused*/, L_236, L_237, L_238, L_239, L_240, (bool)0, (bool)1, /*hidden argument*/NULL);
- V_48 = L_241;
- ObjectTranslator_t2020767555 * L_242 = V_0;
- intptr_t L_243 = ___L0;
- Tweener_t436044680 * L_244 = V_48;
- NullCheck(L_242);
- ObjectTranslator_Push_m105918116(L_242, L_243, L_244, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_04da:
- {
- int32_t L_245 = V_2;
- if ((!(((uint32_t)L_245) == ((uint32_t)4))))
- {
- goto IL_054b;
- }
- }
- IL_04e1:
- {
- intptr_t L_246 = ___L0;
- int32_t L_247 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_246, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_247) == ((uint32_t)3))))
- {
- goto IL_054b;
- }
- }
- IL_04ee:
- {
- ObjectTranslator_t2020767555 * L_248 = V_0;
- intptr_t L_249 = ___L0;
- NullCheck(L_248);
- bool L_250 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_248, L_249, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_250)
- {
- goto IL_054b;
- }
- }
- IL_04fb:
- {
- intptr_t L_251 = ___L0;
- int32_t L_252 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_251, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_252) == ((uint32_t)3))))
- {
- goto IL_054b;
- }
- }
- IL_0508:
- {
- intptr_t L_253 = ___L0;
- double L_254 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_253, 2, /*hidden argument*/NULL);
- V_49 = (((float)((float)L_254)));
- ObjectTranslator_t2020767555 * L_255 = V_0;
- intptr_t L_256 = ___L0;
- NullCheck(L_255);
- ObjectTranslator_Get_m1627229423(L_255, L_256, 3, (&V_50), /*hidden argument*/NULL);
- intptr_t L_257 = ___L0;
- int32_t L_258 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_257, 4, /*hidden argument*/NULL);
- V_51 = L_258;
- Transform_t3600365921 * L_259 = V_1;
- float L_260 = V_49;
- Vector3_t3722313464 L_261 = V_50;
- int32_t L_262 = V_51;
- Tweener_t436044680 * L_263 = ShortcutExtensions_DOShakePosition_m3797325453(NULL /*static, unused*/, L_259, L_260, L_261, L_262, (90.0f), (bool)0, (bool)1, /*hidden argument*/NULL);
- V_52 = L_263;
- ObjectTranslator_t2020767555 * L_264 = V_0;
- intptr_t L_265 = ___L0;
- Tweener_t436044680 * L_266 = V_52;
- NullCheck(L_264);
- ObjectTranslator_Push_m105918116(L_264, L_265, L_266, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_054b:
- {
- int32_t L_267 = V_2;
- if ((!(((uint32_t)L_267) == ((uint32_t)3))))
- {
- goto IL_05a6;
- }
- }
- IL_0552:
- {
- intptr_t L_268 = ___L0;
- int32_t L_269 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_268, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_269) == ((uint32_t)3))))
- {
- goto IL_05a6;
- }
- }
- IL_055f:
- {
- ObjectTranslator_t2020767555 * L_270 = V_0;
- intptr_t L_271 = ___L0;
- NullCheck(L_270);
- bool L_272 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_270, L_271, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_272)
- {
- goto IL_05a6;
- }
- }
- IL_056c:
- {
- intptr_t L_273 = ___L0;
- double L_274 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_273, 2, /*hidden argument*/NULL);
- V_53 = (((float)((float)L_274)));
- ObjectTranslator_t2020767555 * L_275 = V_0;
- intptr_t L_276 = ___L0;
- NullCheck(L_275);
- ObjectTranslator_Get_m1627229423(L_275, L_276, 3, (&V_54), /*hidden argument*/NULL);
- Transform_t3600365921 * L_277 = V_1;
- float L_278 = V_53;
- Vector3_t3722313464 L_279 = V_54;
- Tweener_t436044680 * L_280 = ShortcutExtensions_DOShakePosition_m3797325453(NULL /*static, unused*/, L_277, L_278, L_279, ((int32_t)10), (90.0f), (bool)0, (bool)1, /*hidden argument*/NULL);
- V_55 = L_280;
- ObjectTranslator_t2020767555 * L_281 = V_0;
- intptr_t L_282 = ___L0;
- Tweener_t436044680 * L_283 = V_55;
- NullCheck(L_281);
- ObjectTranslator_Push_m105918116(L_281, L_282, L_283, /*hidden argument*/NULL);
- V_10 = 1;
- goto IL_05d2;
- }
- IL_05a6:
- {
- goto IL_05c6;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_05ab;
- throw e;
- }
- CATCH_05ab:
- { // begin catch(System.Exception)
- V_56 = ((Exception_t *)__exception_local);
- intptr_t L_284 = ___L0;
- Exception_t * L_285 = V_56;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_286 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_285, /*hidden argument*/NULL);
- int32_t L_287 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_284, L_286, /*hidden argument*/NULL);
- V_10 = L_287;
- goto IL_05d2;
- } // end catch (depth: 1)
- IL_05c6:
- {
- intptr_t L_288 = ___L0;
- int32_t L_289 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_288, _stringLiteral2939556566, /*hidden argument*/NULL);
- return L_289;
- }
- IL_05d2:
- {
- int32_t L_290 = V_10;
- return L_290;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOShakeRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOShakeRotation_m241003690 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOShakeRotation_m241003690_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- bool V_7 = false;
- Tweener_t436044680 * V_8 = NULL;
- int32_t V_9 = 0;
- float V_10 = 0.0f;
- float V_11 = 0.0f;
- int32_t V_12 = 0;
- float V_13 = 0.0f;
- Tweener_t436044680 * V_14 = NULL;
- float V_15 = 0.0f;
- float V_16 = 0.0f;
- int32_t V_17 = 0;
- Tweener_t436044680 * V_18 = NULL;
- float V_19 = 0.0f;
- float V_20 = 0.0f;
- Tweener_t436044680 * V_21 = NULL;
- float V_22 = 0.0f;
- Tweener_t436044680 * V_23 = NULL;
- float V_24 = 0.0f;
- Vector3_t3722313464 V_25;
- memset(&V_25, 0, sizeof(V_25));
- int32_t V_26 = 0;
- float V_27 = 0.0f;
- bool V_28 = false;
- Tweener_t436044680 * V_29 = NULL;
- float V_30 = 0.0f;
- Vector3_t3722313464 V_31;
- memset(&V_31, 0, sizeof(V_31));
- int32_t V_32 = 0;
- float V_33 = 0.0f;
- Tweener_t436044680 * V_34 = NULL;
- float V_35 = 0.0f;
- Vector3_t3722313464 V_36;
- memset(&V_36, 0, sizeof(V_36));
- int32_t V_37 = 0;
- Tweener_t436044680 * V_38 = NULL;
- float V_39 = 0.0f;
- Vector3_t3722313464 V_40;
- memset(&V_40, 0, sizeof(V_40));
- Tweener_t436044680 * V_41 = NULL;
- Exception_t * V_42 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)6))))
- {
- goto IL_00ba;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- int32_t L_16 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_15, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_16) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_005c:
- {
- intptr_t L_17 = ___L0;
- int32_t L_18 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_17, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_18) == ((uint32_t)1))))
- {
- goto IL_00ba;
- }
- }
- IL_0069:
- {
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_20)));
- intptr_t L_21 = ___L0;
- double L_22 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_21, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_22)));
- intptr_t L_23 = ___L0;
- int32_t L_24 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_23, 4, /*hidden argument*/NULL);
- V_5 = L_24;
- intptr_t L_25 = ___L0;
- double L_26 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_25, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_26)));
- intptr_t L_27 = ___L0;
- bool L_28 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_27, 6, /*hidden argument*/NULL);
- V_7 = L_28;
- Transform_t3600365921 * L_29 = V_1;
- float L_30 = V_3;
- float L_31 = V_4;
- int32_t L_32 = V_5;
- float L_33 = V_6;
- bool L_34 = V_7;
- Tweener_t436044680 * L_35 = ShortcutExtensions_DOShakeRotation_m4209883749(NULL /*static, unused*/, L_29, L_30, L_31, L_32, L_33, L_34, /*hidden argument*/NULL);
- V_8 = L_35;
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- Tweener_t436044680 * L_38 = V_8;
- NullCheck(L_36);
- ObjectTranslator_Push_m105918116(L_36, L_37, L_38, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_00ba:
- {
- int32_t L_39 = V_2;
- if ((!(((uint32_t)L_39) == ((uint32_t)5))))
- {
- goto IL_013e;
- }
- }
- IL_00c1:
- {
- intptr_t L_40 = ___L0;
- int32_t L_41 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_40, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_41) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00ce:
- {
- intptr_t L_42 = ___L0;
- int32_t L_43 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_42, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_43) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00db:
- {
- intptr_t L_44 = ___L0;
- int32_t L_45 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_44, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_45) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00e8:
- {
- intptr_t L_46 = ___L0;
- int32_t L_47 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_46, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_47) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00f5:
- {
- intptr_t L_48 = ___L0;
- double L_49 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_48, 2, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_49)));
- intptr_t L_50 = ___L0;
- double L_51 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_50, 3, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_51)));
- intptr_t L_52 = ___L0;
- int32_t L_53 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_52, 4, /*hidden argument*/NULL);
- V_12 = L_53;
- intptr_t L_54 = ___L0;
- double L_55 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_54, 5, /*hidden argument*/NULL);
- V_13 = (((float)((float)L_55)));
- Transform_t3600365921 * L_56 = V_1;
- float L_57 = V_10;
- float L_58 = V_11;
- int32_t L_59 = V_12;
- float L_60 = V_13;
- Tweener_t436044680 * L_61 = ShortcutExtensions_DOShakeRotation_m4209883749(NULL /*static, unused*/, L_56, L_57, L_58, L_59, L_60, (bool)1, /*hidden argument*/NULL);
- V_14 = L_61;
- ObjectTranslator_t2020767555 * L_62 = V_0;
- intptr_t L_63 = ___L0;
- Tweener_t436044680 * L_64 = V_14;
- NullCheck(L_62);
- ObjectTranslator_Push_m105918116(L_62, L_63, L_64, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_013e:
- {
- int32_t L_65 = V_2;
- if ((!(((uint32_t)L_65) == ((uint32_t)4))))
- {
- goto IL_01ae;
- }
- }
- IL_0145:
- {
- intptr_t L_66 = ___L0;
- int32_t L_67 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_66, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_67) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_0152:
- {
- intptr_t L_68 = ___L0;
- int32_t L_69 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_68, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_69) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_015f:
- {
- intptr_t L_70 = ___L0;
- int32_t L_71 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_70, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_71) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_016c:
- {
- intptr_t L_72 = ___L0;
- double L_73 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_72, 2, /*hidden argument*/NULL);
- V_15 = (((float)((float)L_73)));
- intptr_t L_74 = ___L0;
- double L_75 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_74, 3, /*hidden argument*/NULL);
- V_16 = (((float)((float)L_75)));
- intptr_t L_76 = ___L0;
- int32_t L_77 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_76, 4, /*hidden argument*/NULL);
- V_17 = L_77;
- Transform_t3600365921 * L_78 = V_1;
- float L_79 = V_15;
- float L_80 = V_16;
- int32_t L_81 = V_17;
- Tweener_t436044680 * L_82 = ShortcutExtensions_DOShakeRotation_m4209883749(NULL /*static, unused*/, L_78, L_79, L_80, L_81, (90.0f), (bool)1, /*hidden argument*/NULL);
- V_18 = L_82;
- ObjectTranslator_t2020767555 * L_83 = V_0;
- intptr_t L_84 = ___L0;
- Tweener_t436044680 * L_85 = V_18;
- NullCheck(L_83);
- ObjectTranslator_Push_m105918116(L_83, L_84, L_85, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_01ae:
- {
- int32_t L_86 = V_2;
- if ((!(((uint32_t)L_86) == ((uint32_t)3))))
- {
- goto IL_0208;
- }
- }
- IL_01b5:
- {
- intptr_t L_87 = ___L0;
- int32_t L_88 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_87, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_88) == ((uint32_t)3))))
- {
- goto IL_0208;
- }
- }
- IL_01c2:
- {
- intptr_t L_89 = ___L0;
- int32_t L_90 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_89, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_90) == ((uint32_t)3))))
- {
- goto IL_0208;
- }
- }
- IL_01cf:
- {
- intptr_t L_91 = ___L0;
- double L_92 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_91, 2, /*hidden argument*/NULL);
- V_19 = (((float)((float)L_92)));
- intptr_t L_93 = ___L0;
- double L_94 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_93, 3, /*hidden argument*/NULL);
- V_20 = (((float)((float)L_94)));
- Transform_t3600365921 * L_95 = V_1;
- float L_96 = V_19;
- float L_97 = V_20;
- Tweener_t436044680 * L_98 = ShortcutExtensions_DOShakeRotation_m4209883749(NULL /*static, unused*/, L_95, L_96, L_97, ((int32_t)10), (90.0f), (bool)1, /*hidden argument*/NULL);
- V_21 = L_98;
- ObjectTranslator_t2020767555 * L_99 = V_0;
- intptr_t L_100 = ___L0;
- Tweener_t436044680 * L_101 = V_21;
- NullCheck(L_99);
- ObjectTranslator_Push_m105918116(L_99, L_100, L_101, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_0208:
- {
- int32_t L_102 = V_2;
- if ((!(((uint32_t)L_102) == ((uint32_t)2))))
- {
- goto IL_024e;
- }
- }
- IL_020f:
- {
- intptr_t L_103 = ___L0;
- int32_t L_104 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_103, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_104) == ((uint32_t)3))))
- {
- goto IL_024e;
- }
- }
- IL_021c:
- {
- intptr_t L_105 = ___L0;
- double L_106 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_105, 2, /*hidden argument*/NULL);
- V_22 = (((float)((float)L_106)));
- Transform_t3600365921 * L_107 = V_1;
- float L_108 = V_22;
- Tweener_t436044680 * L_109 = ShortcutExtensions_DOShakeRotation_m4209883749(NULL /*static, unused*/, L_107, L_108, (90.0f), ((int32_t)10), (90.0f), (bool)1, /*hidden argument*/NULL);
- V_23 = L_109;
- ObjectTranslator_t2020767555 * L_110 = V_0;
- intptr_t L_111 = ___L0;
- Tweener_t436044680 * L_112 = V_23;
- NullCheck(L_110);
- ObjectTranslator_Push_m105918116(L_110, L_111, L_112, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_024e:
- {
- int32_t L_113 = V_2;
- if ((!(((uint32_t)L_113) == ((uint32_t)6))))
- {
- goto IL_02e9;
- }
- }
- IL_0255:
- {
- intptr_t L_114 = ___L0;
- int32_t L_115 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_114, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_115) == ((uint32_t)3))))
- {
- goto IL_02e9;
- }
- }
- IL_0262:
- {
- ObjectTranslator_t2020767555 * L_116 = V_0;
- intptr_t L_117 = ___L0;
- NullCheck(L_116);
- bool L_118 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_116, L_117, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_118)
- {
- goto IL_02e9;
- }
- }
- IL_026f:
- {
- intptr_t L_119 = ___L0;
- int32_t L_120 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_119, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_120) == ((uint32_t)3))))
- {
- goto IL_02e9;
- }
- }
- IL_027c:
- {
- intptr_t L_121 = ___L0;
- int32_t L_122 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_121, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_122) == ((uint32_t)3))))
- {
- goto IL_02e9;
- }
- }
- IL_0289:
- {
- intptr_t L_123 = ___L0;
- int32_t L_124 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_123, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_124) == ((uint32_t)1))))
- {
- goto IL_02e9;
- }
- }
- IL_0296:
- {
- intptr_t L_125 = ___L0;
- double L_126 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_125, 2, /*hidden argument*/NULL);
- V_24 = (((float)((float)L_126)));
- ObjectTranslator_t2020767555 * L_127 = V_0;
- intptr_t L_128 = ___L0;
- NullCheck(L_127);
- ObjectTranslator_Get_m1627229423(L_127, L_128, 3, (&V_25), /*hidden argument*/NULL);
- intptr_t L_129 = ___L0;
- int32_t L_130 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_129, 4, /*hidden argument*/NULL);
- V_26 = L_130;
- intptr_t L_131 = ___L0;
- double L_132 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_131, 5, /*hidden argument*/NULL);
- V_27 = (((float)((float)L_132)));
- intptr_t L_133 = ___L0;
- bool L_134 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_133, 6, /*hidden argument*/NULL);
- V_28 = L_134;
- Transform_t3600365921 * L_135 = V_1;
- float L_136 = V_24;
- Vector3_t3722313464 L_137 = V_25;
- int32_t L_138 = V_26;
- float L_139 = V_27;
- bool L_140 = V_28;
- Tweener_t436044680 * L_141 = ShortcutExtensions_DOShakeRotation_m2216829550(NULL /*static, unused*/, L_135, L_136, L_137, L_138, L_139, L_140, /*hidden argument*/NULL);
- V_29 = L_141;
- ObjectTranslator_t2020767555 * L_142 = V_0;
- intptr_t L_143 = ___L0;
- Tweener_t436044680 * L_144 = V_29;
- NullCheck(L_142);
- ObjectTranslator_Push_m105918116(L_142, L_143, L_144, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_02e9:
- {
- int32_t L_145 = V_2;
- if ((!(((uint32_t)L_145) == ((uint32_t)5))))
- {
- goto IL_036d;
- }
- }
- IL_02f0:
- {
- intptr_t L_146 = ___L0;
- int32_t L_147 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_146, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_147) == ((uint32_t)3))))
- {
- goto IL_036d;
- }
- }
- IL_02fd:
- {
- ObjectTranslator_t2020767555 * L_148 = V_0;
- intptr_t L_149 = ___L0;
- NullCheck(L_148);
- bool L_150 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_148, L_149, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_150)
- {
- goto IL_036d;
- }
- }
- IL_030a:
- {
- intptr_t L_151 = ___L0;
- int32_t L_152 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_151, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_152) == ((uint32_t)3))))
- {
- goto IL_036d;
- }
- }
- IL_0317:
- {
- intptr_t L_153 = ___L0;
- int32_t L_154 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_153, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_154) == ((uint32_t)3))))
- {
- goto IL_036d;
- }
- }
- IL_0324:
- {
- intptr_t L_155 = ___L0;
- double L_156 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_155, 2, /*hidden argument*/NULL);
- V_30 = (((float)((float)L_156)));
- ObjectTranslator_t2020767555 * L_157 = V_0;
- intptr_t L_158 = ___L0;
- NullCheck(L_157);
- ObjectTranslator_Get_m1627229423(L_157, L_158, 3, (&V_31), /*hidden argument*/NULL);
- intptr_t L_159 = ___L0;
- int32_t L_160 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_159, 4, /*hidden argument*/NULL);
- V_32 = L_160;
- intptr_t L_161 = ___L0;
- double L_162 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_161, 5, /*hidden argument*/NULL);
- V_33 = (((float)((float)L_162)));
- Transform_t3600365921 * L_163 = V_1;
- float L_164 = V_30;
- Vector3_t3722313464 L_165 = V_31;
- int32_t L_166 = V_32;
- float L_167 = V_33;
- Tweener_t436044680 * L_168 = ShortcutExtensions_DOShakeRotation_m2216829550(NULL /*static, unused*/, L_163, L_164, L_165, L_166, L_167, (bool)1, /*hidden argument*/NULL);
- V_34 = L_168;
- ObjectTranslator_t2020767555 * L_169 = V_0;
- intptr_t L_170 = ___L0;
- Tweener_t436044680 * L_171 = V_34;
- NullCheck(L_169);
- ObjectTranslator_Push_m105918116(L_169, L_170, L_171, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_036d:
- {
- int32_t L_172 = V_2;
- if ((!(((uint32_t)L_172) == ((uint32_t)4))))
- {
- goto IL_03dd;
- }
- }
- IL_0374:
- {
- intptr_t L_173 = ___L0;
- int32_t L_174 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_173, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_174) == ((uint32_t)3))))
- {
- goto IL_03dd;
- }
- }
- IL_0381:
- {
- ObjectTranslator_t2020767555 * L_175 = V_0;
- intptr_t L_176 = ___L0;
- NullCheck(L_175);
- bool L_177 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_175, L_176, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_177)
- {
- goto IL_03dd;
- }
- }
- IL_038e:
- {
- intptr_t L_178 = ___L0;
- int32_t L_179 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_178, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_179) == ((uint32_t)3))))
- {
- goto IL_03dd;
- }
- }
- IL_039b:
- {
- intptr_t L_180 = ___L0;
- double L_181 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_180, 2, /*hidden argument*/NULL);
- V_35 = (((float)((float)L_181)));
- ObjectTranslator_t2020767555 * L_182 = V_0;
- intptr_t L_183 = ___L0;
- NullCheck(L_182);
- ObjectTranslator_Get_m1627229423(L_182, L_183, 3, (&V_36), /*hidden argument*/NULL);
- intptr_t L_184 = ___L0;
- int32_t L_185 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_184, 4, /*hidden argument*/NULL);
- V_37 = L_185;
- Transform_t3600365921 * L_186 = V_1;
- float L_187 = V_35;
- Vector3_t3722313464 L_188 = V_36;
- int32_t L_189 = V_37;
- Tweener_t436044680 * L_190 = ShortcutExtensions_DOShakeRotation_m2216829550(NULL /*static, unused*/, L_186, L_187, L_188, L_189, (90.0f), (bool)1, /*hidden argument*/NULL);
- V_38 = L_190;
- ObjectTranslator_t2020767555 * L_191 = V_0;
- intptr_t L_192 = ___L0;
- Tweener_t436044680 * L_193 = V_38;
- NullCheck(L_191);
- ObjectTranslator_Push_m105918116(L_191, L_192, L_193, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_03dd:
- {
- int32_t L_194 = V_2;
- if ((!(((uint32_t)L_194) == ((uint32_t)3))))
- {
- goto IL_0437;
- }
- }
- IL_03e4:
- {
- intptr_t L_195 = ___L0;
- int32_t L_196 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_195, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_196) == ((uint32_t)3))))
- {
- goto IL_0437;
- }
- }
- IL_03f1:
- {
- ObjectTranslator_t2020767555 * L_197 = V_0;
- intptr_t L_198 = ___L0;
- NullCheck(L_197);
- bool L_199 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_197, L_198, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_199)
- {
- goto IL_0437;
- }
- }
- IL_03fe:
- {
- intptr_t L_200 = ___L0;
- double L_201 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_200, 2, /*hidden argument*/NULL);
- V_39 = (((float)((float)L_201)));
- ObjectTranslator_t2020767555 * L_202 = V_0;
- intptr_t L_203 = ___L0;
- NullCheck(L_202);
- ObjectTranslator_Get_m1627229423(L_202, L_203, 3, (&V_40), /*hidden argument*/NULL);
- Transform_t3600365921 * L_204 = V_1;
- float L_205 = V_39;
- Vector3_t3722313464 L_206 = V_40;
- Tweener_t436044680 * L_207 = ShortcutExtensions_DOShakeRotation_m2216829550(NULL /*static, unused*/, L_204, L_205, L_206, ((int32_t)10), (90.0f), (bool)1, /*hidden argument*/NULL);
- V_41 = L_207;
- ObjectTranslator_t2020767555 * L_208 = V_0;
- intptr_t L_209 = ___L0;
- Tweener_t436044680 * L_210 = V_41;
- NullCheck(L_208);
- ObjectTranslator_Push_m105918116(L_208, L_209, L_210, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_0437:
- {
- goto IL_0457;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_043c;
- throw e;
- }
- CATCH_043c:
- { // begin catch(System.Exception)
- V_42 = ((Exception_t *)__exception_local);
- intptr_t L_211 = ___L0;
- Exception_t * L_212 = V_42;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_213 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_212, /*hidden argument*/NULL);
- int32_t L_214 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_211, L_213, /*hidden argument*/NULL);
- V_9 = L_214;
- goto IL_0463;
- } // end catch (depth: 1)
- IL_0457:
- {
- intptr_t L_215 = ___L0;
- int32_t L_216 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_215, _stringLiteral3401268765, /*hidden argument*/NULL);
- return L_216;
- }
- IL_0463:
- {
- int32_t L_217 = V_9;
- return L_217;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOShakeScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOShakeScale_m2406116869 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOShakeScale_m2406116869_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- float V_3 = 0.0f;
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- bool V_7 = false;
- Tweener_t436044680 * V_8 = NULL;
- int32_t V_9 = 0;
- float V_10 = 0.0f;
- float V_11 = 0.0f;
- int32_t V_12 = 0;
- float V_13 = 0.0f;
- Tweener_t436044680 * V_14 = NULL;
- float V_15 = 0.0f;
- float V_16 = 0.0f;
- int32_t V_17 = 0;
- Tweener_t436044680 * V_18 = NULL;
- float V_19 = 0.0f;
- float V_20 = 0.0f;
- Tweener_t436044680 * V_21 = NULL;
- float V_22 = 0.0f;
- Tweener_t436044680 * V_23 = NULL;
- float V_24 = 0.0f;
- Vector3_t3722313464 V_25;
- memset(&V_25, 0, sizeof(V_25));
- int32_t V_26 = 0;
- float V_27 = 0.0f;
- bool V_28 = false;
- Tweener_t436044680 * V_29 = NULL;
- float V_30 = 0.0f;
- Vector3_t3722313464 V_31;
- memset(&V_31, 0, sizeof(V_31));
- int32_t V_32 = 0;
- float V_33 = 0.0f;
- Tweener_t436044680 * V_34 = NULL;
- float V_35 = 0.0f;
- Vector3_t3722313464 V_36;
- memset(&V_36, 0, sizeof(V_36));
- int32_t V_37 = 0;
- Tweener_t436044680 * V_38 = NULL;
- float V_39 = 0.0f;
- Vector3_t3722313464 V_40;
- memset(&V_40, 0, sizeof(V_40));
- Tweener_t436044680 * V_41 = NULL;
- Exception_t * V_42 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)6))))
- {
- goto IL_00ba;
- }
- }
- IL_0028:
- {
- intptr_t L_9 = ___L0;
- int32_t L_10 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_10) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_0035:
- {
- intptr_t L_11 = ___L0;
- int32_t L_12 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_12) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_0042:
- {
- intptr_t L_13 = ___L0;
- int32_t L_14 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_13, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_14) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_004f:
- {
- intptr_t L_15 = ___L0;
- int32_t L_16 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_15, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_16) == ((uint32_t)3))))
- {
- goto IL_00ba;
- }
- }
- IL_005c:
- {
- intptr_t L_17 = ___L0;
- int32_t L_18 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_17, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_18) == ((uint32_t)1))))
- {
- goto IL_00ba;
- }
- }
- IL_0069:
- {
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 2, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_20)));
- intptr_t L_21 = ___L0;
- double L_22 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_21, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_22)));
- intptr_t L_23 = ___L0;
- int32_t L_24 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_23, 4, /*hidden argument*/NULL);
- V_5 = L_24;
- intptr_t L_25 = ___L0;
- double L_26 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_25, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_26)));
- intptr_t L_27 = ___L0;
- bool L_28 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_27, 6, /*hidden argument*/NULL);
- V_7 = L_28;
- Transform_t3600365921 * L_29 = V_1;
- float L_30 = V_3;
- float L_31 = V_4;
- int32_t L_32 = V_5;
- float L_33 = V_6;
- bool L_34 = V_7;
- Tweener_t436044680 * L_35 = ShortcutExtensions_DOShakeScale_m1145516565(NULL /*static, unused*/, L_29, L_30, L_31, L_32, L_33, L_34, /*hidden argument*/NULL);
- V_8 = L_35;
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- Tweener_t436044680 * L_38 = V_8;
- NullCheck(L_36);
- ObjectTranslator_Push_m105918116(L_36, L_37, L_38, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_00ba:
- {
- int32_t L_39 = V_2;
- if ((!(((uint32_t)L_39) == ((uint32_t)5))))
- {
- goto IL_013e;
- }
- }
- IL_00c1:
- {
- intptr_t L_40 = ___L0;
- int32_t L_41 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_40, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_41) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00ce:
- {
- intptr_t L_42 = ___L0;
- int32_t L_43 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_42, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_43) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00db:
- {
- intptr_t L_44 = ___L0;
- int32_t L_45 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_44, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_45) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00e8:
- {
- intptr_t L_46 = ___L0;
- int32_t L_47 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_46, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_47) == ((uint32_t)3))))
- {
- goto IL_013e;
- }
- }
- IL_00f5:
- {
- intptr_t L_48 = ___L0;
- double L_49 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_48, 2, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_49)));
- intptr_t L_50 = ___L0;
- double L_51 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_50, 3, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_51)));
- intptr_t L_52 = ___L0;
- int32_t L_53 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_52, 4, /*hidden argument*/NULL);
- V_12 = L_53;
- intptr_t L_54 = ___L0;
- double L_55 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_54, 5, /*hidden argument*/NULL);
- V_13 = (((float)((float)L_55)));
- Transform_t3600365921 * L_56 = V_1;
- float L_57 = V_10;
- float L_58 = V_11;
- int32_t L_59 = V_12;
- float L_60 = V_13;
- Tweener_t436044680 * L_61 = ShortcutExtensions_DOShakeScale_m1145516565(NULL /*static, unused*/, L_56, L_57, L_58, L_59, L_60, (bool)1, /*hidden argument*/NULL);
- V_14 = L_61;
- ObjectTranslator_t2020767555 * L_62 = V_0;
- intptr_t L_63 = ___L0;
- Tweener_t436044680 * L_64 = V_14;
- NullCheck(L_62);
- ObjectTranslator_Push_m105918116(L_62, L_63, L_64, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_013e:
- {
- int32_t L_65 = V_2;
- if ((!(((uint32_t)L_65) == ((uint32_t)4))))
- {
- goto IL_01ae;
- }
- }
- IL_0145:
- {
- intptr_t L_66 = ___L0;
- int32_t L_67 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_66, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_67) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_0152:
- {
- intptr_t L_68 = ___L0;
- int32_t L_69 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_68, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_69) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_015f:
- {
- intptr_t L_70 = ___L0;
- int32_t L_71 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_70, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_71) == ((uint32_t)3))))
- {
- goto IL_01ae;
- }
- }
- IL_016c:
- {
- intptr_t L_72 = ___L0;
- double L_73 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_72, 2, /*hidden argument*/NULL);
- V_15 = (((float)((float)L_73)));
- intptr_t L_74 = ___L0;
- double L_75 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_74, 3, /*hidden argument*/NULL);
- V_16 = (((float)((float)L_75)));
- intptr_t L_76 = ___L0;
- int32_t L_77 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_76, 4, /*hidden argument*/NULL);
- V_17 = L_77;
- Transform_t3600365921 * L_78 = V_1;
- float L_79 = V_15;
- float L_80 = V_16;
- int32_t L_81 = V_17;
- Tweener_t436044680 * L_82 = ShortcutExtensions_DOShakeScale_m1145516565(NULL /*static, unused*/, L_78, L_79, L_80, L_81, (90.0f), (bool)1, /*hidden argument*/NULL);
- V_18 = L_82;
- ObjectTranslator_t2020767555 * L_83 = V_0;
- intptr_t L_84 = ___L0;
- Tweener_t436044680 * L_85 = V_18;
- NullCheck(L_83);
- ObjectTranslator_Push_m105918116(L_83, L_84, L_85, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_01ae:
- {
- int32_t L_86 = V_2;
- if ((!(((uint32_t)L_86) == ((uint32_t)3))))
- {
- goto IL_0208;
- }
- }
- IL_01b5:
- {
- intptr_t L_87 = ___L0;
- int32_t L_88 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_87, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_88) == ((uint32_t)3))))
- {
- goto IL_0208;
- }
- }
- IL_01c2:
- {
- intptr_t L_89 = ___L0;
- int32_t L_90 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_89, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_90) == ((uint32_t)3))))
- {
- goto IL_0208;
- }
- }
- IL_01cf:
- {
- intptr_t L_91 = ___L0;
- double L_92 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_91, 2, /*hidden argument*/NULL);
- V_19 = (((float)((float)L_92)));
- intptr_t L_93 = ___L0;
- double L_94 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_93, 3, /*hidden argument*/NULL);
- V_20 = (((float)((float)L_94)));
- Transform_t3600365921 * L_95 = V_1;
- float L_96 = V_19;
- float L_97 = V_20;
- Tweener_t436044680 * L_98 = ShortcutExtensions_DOShakeScale_m1145516565(NULL /*static, unused*/, L_95, L_96, L_97, ((int32_t)10), (90.0f), (bool)1, /*hidden argument*/NULL);
- V_21 = L_98;
- ObjectTranslator_t2020767555 * L_99 = V_0;
- intptr_t L_100 = ___L0;
- Tweener_t436044680 * L_101 = V_21;
- NullCheck(L_99);
- ObjectTranslator_Push_m105918116(L_99, L_100, L_101, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_0208:
- {
- int32_t L_102 = V_2;
- if ((!(((uint32_t)L_102) == ((uint32_t)2))))
- {
- goto IL_024e;
- }
- }
- IL_020f:
- {
- intptr_t L_103 = ___L0;
- int32_t L_104 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_103, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_104) == ((uint32_t)3))))
- {
- goto IL_024e;
- }
- }
- IL_021c:
- {
- intptr_t L_105 = ___L0;
- double L_106 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_105, 2, /*hidden argument*/NULL);
- V_22 = (((float)((float)L_106)));
- Transform_t3600365921 * L_107 = V_1;
- float L_108 = V_22;
- Tweener_t436044680 * L_109 = ShortcutExtensions_DOShakeScale_m1145516565(NULL /*static, unused*/, L_107, L_108, (1.0f), ((int32_t)10), (90.0f), (bool)1, /*hidden argument*/NULL);
- V_23 = L_109;
- ObjectTranslator_t2020767555 * L_110 = V_0;
- intptr_t L_111 = ___L0;
- Tweener_t436044680 * L_112 = V_23;
- NullCheck(L_110);
- ObjectTranslator_Push_m105918116(L_110, L_111, L_112, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_024e:
- {
- int32_t L_113 = V_2;
- if ((!(((uint32_t)L_113) == ((uint32_t)6))))
- {
- goto IL_02e9;
- }
- }
- IL_0255:
- {
- intptr_t L_114 = ___L0;
- int32_t L_115 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_114, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_115) == ((uint32_t)3))))
- {
- goto IL_02e9;
- }
- }
- IL_0262:
- {
- ObjectTranslator_t2020767555 * L_116 = V_0;
- intptr_t L_117 = ___L0;
- NullCheck(L_116);
- bool L_118 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_116, L_117, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_118)
- {
- goto IL_02e9;
- }
- }
- IL_026f:
- {
- intptr_t L_119 = ___L0;
- int32_t L_120 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_119, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_120) == ((uint32_t)3))))
- {
- goto IL_02e9;
- }
- }
- IL_027c:
- {
- intptr_t L_121 = ___L0;
- int32_t L_122 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_121, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_122) == ((uint32_t)3))))
- {
- goto IL_02e9;
- }
- }
- IL_0289:
- {
- intptr_t L_123 = ___L0;
- int32_t L_124 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_123, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_124) == ((uint32_t)1))))
- {
- goto IL_02e9;
- }
- }
- IL_0296:
- {
- intptr_t L_125 = ___L0;
- double L_126 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_125, 2, /*hidden argument*/NULL);
- V_24 = (((float)((float)L_126)));
- ObjectTranslator_t2020767555 * L_127 = V_0;
- intptr_t L_128 = ___L0;
- NullCheck(L_127);
- ObjectTranslator_Get_m1627229423(L_127, L_128, 3, (&V_25), /*hidden argument*/NULL);
- intptr_t L_129 = ___L0;
- int32_t L_130 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_129, 4, /*hidden argument*/NULL);
- V_26 = L_130;
- intptr_t L_131 = ___L0;
- double L_132 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_131, 5, /*hidden argument*/NULL);
- V_27 = (((float)((float)L_132)));
- intptr_t L_133 = ___L0;
- bool L_134 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_133, 6, /*hidden argument*/NULL);
- V_28 = L_134;
- Transform_t3600365921 * L_135 = V_1;
- float L_136 = V_24;
- Vector3_t3722313464 L_137 = V_25;
- int32_t L_138 = V_26;
- float L_139 = V_27;
- bool L_140 = V_28;
- Tweener_t436044680 * L_141 = ShortcutExtensions_DOShakeScale_m2697446006(NULL /*static, unused*/, L_135, L_136, L_137, L_138, L_139, L_140, /*hidden argument*/NULL);
- V_29 = L_141;
- ObjectTranslator_t2020767555 * L_142 = V_0;
- intptr_t L_143 = ___L0;
- Tweener_t436044680 * L_144 = V_29;
- NullCheck(L_142);
- ObjectTranslator_Push_m105918116(L_142, L_143, L_144, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_02e9:
- {
- int32_t L_145 = V_2;
- if ((!(((uint32_t)L_145) == ((uint32_t)5))))
- {
- goto IL_036d;
- }
- }
- IL_02f0:
- {
- intptr_t L_146 = ___L0;
- int32_t L_147 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_146, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_147) == ((uint32_t)3))))
- {
- goto IL_036d;
- }
- }
- IL_02fd:
- {
- ObjectTranslator_t2020767555 * L_148 = V_0;
- intptr_t L_149 = ___L0;
- NullCheck(L_148);
- bool L_150 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_148, L_149, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_150)
- {
- goto IL_036d;
- }
- }
- IL_030a:
- {
- intptr_t L_151 = ___L0;
- int32_t L_152 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_151, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_152) == ((uint32_t)3))))
- {
- goto IL_036d;
- }
- }
- IL_0317:
- {
- intptr_t L_153 = ___L0;
- int32_t L_154 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_153, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_154) == ((uint32_t)3))))
- {
- goto IL_036d;
- }
- }
- IL_0324:
- {
- intptr_t L_155 = ___L0;
- double L_156 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_155, 2, /*hidden argument*/NULL);
- V_30 = (((float)((float)L_156)));
- ObjectTranslator_t2020767555 * L_157 = V_0;
- intptr_t L_158 = ___L0;
- NullCheck(L_157);
- ObjectTranslator_Get_m1627229423(L_157, L_158, 3, (&V_31), /*hidden argument*/NULL);
- intptr_t L_159 = ___L0;
- int32_t L_160 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_159, 4, /*hidden argument*/NULL);
- V_32 = L_160;
- intptr_t L_161 = ___L0;
- double L_162 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_161, 5, /*hidden argument*/NULL);
- V_33 = (((float)((float)L_162)));
- Transform_t3600365921 * L_163 = V_1;
- float L_164 = V_30;
- Vector3_t3722313464 L_165 = V_31;
- int32_t L_166 = V_32;
- float L_167 = V_33;
- Tweener_t436044680 * L_168 = ShortcutExtensions_DOShakeScale_m2697446006(NULL /*static, unused*/, L_163, L_164, L_165, L_166, L_167, (bool)1, /*hidden argument*/NULL);
- V_34 = L_168;
- ObjectTranslator_t2020767555 * L_169 = V_0;
- intptr_t L_170 = ___L0;
- Tweener_t436044680 * L_171 = V_34;
- NullCheck(L_169);
- ObjectTranslator_Push_m105918116(L_169, L_170, L_171, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_036d:
- {
- int32_t L_172 = V_2;
- if ((!(((uint32_t)L_172) == ((uint32_t)4))))
- {
- goto IL_03dd;
- }
- }
- IL_0374:
- {
- intptr_t L_173 = ___L0;
- int32_t L_174 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_173, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_174) == ((uint32_t)3))))
- {
- goto IL_03dd;
- }
- }
- IL_0381:
- {
- ObjectTranslator_t2020767555 * L_175 = V_0;
- intptr_t L_176 = ___L0;
- NullCheck(L_175);
- bool L_177 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_175, L_176, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_177)
- {
- goto IL_03dd;
- }
- }
- IL_038e:
- {
- intptr_t L_178 = ___L0;
- int32_t L_179 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_178, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_179) == ((uint32_t)3))))
- {
- goto IL_03dd;
- }
- }
- IL_039b:
- {
- intptr_t L_180 = ___L0;
- double L_181 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_180, 2, /*hidden argument*/NULL);
- V_35 = (((float)((float)L_181)));
- ObjectTranslator_t2020767555 * L_182 = V_0;
- intptr_t L_183 = ___L0;
- NullCheck(L_182);
- ObjectTranslator_Get_m1627229423(L_182, L_183, 3, (&V_36), /*hidden argument*/NULL);
- intptr_t L_184 = ___L0;
- int32_t L_185 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_184, 4, /*hidden argument*/NULL);
- V_37 = L_185;
- Transform_t3600365921 * L_186 = V_1;
- float L_187 = V_35;
- Vector3_t3722313464 L_188 = V_36;
- int32_t L_189 = V_37;
- Tweener_t436044680 * L_190 = ShortcutExtensions_DOShakeScale_m2697446006(NULL /*static, unused*/, L_186, L_187, L_188, L_189, (90.0f), (bool)1, /*hidden argument*/NULL);
- V_38 = L_190;
- ObjectTranslator_t2020767555 * L_191 = V_0;
- intptr_t L_192 = ___L0;
- Tweener_t436044680 * L_193 = V_38;
- NullCheck(L_191);
- ObjectTranslator_Push_m105918116(L_191, L_192, L_193, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_03dd:
- {
- int32_t L_194 = V_2;
- if ((!(((uint32_t)L_194) == ((uint32_t)3))))
- {
- goto IL_0437;
- }
- }
- IL_03e4:
- {
- intptr_t L_195 = ___L0;
- int32_t L_196 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_195, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_196) == ((uint32_t)3))))
- {
- goto IL_0437;
- }
- }
- IL_03f1:
- {
- ObjectTranslator_t2020767555 * L_197 = V_0;
- intptr_t L_198 = ___L0;
- NullCheck(L_197);
- bool L_199 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_197, L_198, 3, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_199)
- {
- goto IL_0437;
- }
- }
- IL_03fe:
- {
- intptr_t L_200 = ___L0;
- double L_201 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_200, 2, /*hidden argument*/NULL);
- V_39 = (((float)((float)L_201)));
- ObjectTranslator_t2020767555 * L_202 = V_0;
- intptr_t L_203 = ___L0;
- NullCheck(L_202);
- ObjectTranslator_Get_m1627229423(L_202, L_203, 3, (&V_40), /*hidden argument*/NULL);
- Transform_t3600365921 * L_204 = V_1;
- float L_205 = V_39;
- Vector3_t3722313464 L_206 = V_40;
- Tweener_t436044680 * L_207 = ShortcutExtensions_DOShakeScale_m2697446006(NULL /*static, unused*/, L_204, L_205, L_206, ((int32_t)10), (90.0f), (bool)1, /*hidden argument*/NULL);
- V_41 = L_207;
- ObjectTranslator_t2020767555 * L_208 = V_0;
- intptr_t L_209 = ___L0;
- Tweener_t436044680 * L_210 = V_41;
- NullCheck(L_208);
- ObjectTranslator_Push_m105918116(L_208, L_209, L_210, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_0463;
- }
- IL_0437:
- {
- goto IL_0457;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_043c;
- throw e;
- }
- CATCH_043c:
- { // begin catch(System.Exception)
- V_42 = ((Exception_t *)__exception_local);
- intptr_t L_211 = ___L0;
- Exception_t * L_212 = V_42;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_213 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_212, /*hidden argument*/NULL);
- int32_t L_214 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_211, L_213, /*hidden argument*/NULL);
- V_9 = L_214;
- goto IL_0463;
- } // end catch (depth: 1)
- IL_0457:
- {
- intptr_t L_215 = ___L0;
- int32_t L_216 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_215, _stringLiteral3523906611, /*hidden argument*/NULL);
- return L_216;
- }
- IL_0463:
- {
- int32_t L_217 = V_9;
- return L_217;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOJump(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOJump_m4133327798 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOJump_m4133327798_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- bool V_7 = false;
- Sequence_t2050373119 * V_8 = NULL;
- int32_t V_9 = 0;
- Vector3_t3722313464 V_10;
- memset(&V_10, 0, sizeof(V_10));
- float V_11 = 0.0f;
- int32_t V_12 = 0;
- float V_13 = 0.0f;
- Sequence_t2050373119 * V_14 = NULL;
- Exception_t * V_15 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)6))))
- {
- goto IL_00bb;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00bb;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_004f:
- {
- intptr_t L_16 = ___L0;
- int32_t L_17 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_16, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_17) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_005c:
- {
- intptr_t L_18 = ___L0;
- int32_t L_19 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_18, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_19) == ((uint32_t)1))))
- {
- goto IL_00bb;
- }
- }
- IL_0069:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- NullCheck(L_20);
- ObjectTranslator_Get_m1627229423(L_20, L_21, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- intptr_t L_24 = ___L0;
- int32_t L_25 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_24, 4, /*hidden argument*/NULL);
- V_5 = L_25;
- intptr_t L_26 = ___L0;
- double L_27 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_26, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_27)));
- intptr_t L_28 = ___L0;
- bool L_29 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_28, 6, /*hidden argument*/NULL);
- V_7 = L_29;
- Transform_t3600365921 * L_30 = V_1;
- Vector3_t3722313464 L_31 = V_3;
- float L_32 = V_4;
- int32_t L_33 = V_5;
- float L_34 = V_6;
- bool L_35 = V_7;
- Sequence_t2050373119 * L_36 = ShortcutExtensions_DOJump_m2824502518(NULL /*static, unused*/, L_30, L_31, L_32, L_33, L_34, L_35, /*hidden argument*/NULL);
- V_8 = L_36;
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- Sequence_t2050373119 * L_39 = V_8;
- NullCheck(L_37);
- ObjectTranslator_Push_m105918116(L_37, L_38, L_39, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_016b;
- }
- IL_00bb:
- {
- int32_t L_40 = V_2;
- if ((!(((uint32_t)L_40) == ((uint32_t)5))))
- {
- goto IL_013f;
- }
- }
- IL_00c2:
- {
- ObjectTranslator_t2020767555 * L_41 = V_0;
- intptr_t L_42 = ___L0;
- NullCheck(L_41);
- bool L_43 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_41, L_42, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_43)
- {
- goto IL_013f;
- }
- }
- IL_00cf:
- {
- intptr_t L_44 = ___L0;
- int32_t L_45 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_44, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_45) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00dc:
- {
- intptr_t L_46 = ___L0;
- int32_t L_47 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_46, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_47) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00e9:
- {
- intptr_t L_48 = ___L0;
- int32_t L_49 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_48, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_49) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00f6:
- {
- ObjectTranslator_t2020767555 * L_50 = V_0;
- intptr_t L_51 = ___L0;
- NullCheck(L_50);
- ObjectTranslator_Get_m1627229423(L_50, L_51, 2, (&V_10), /*hidden argument*/NULL);
- intptr_t L_52 = ___L0;
- double L_53 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_52, 3, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_53)));
- intptr_t L_54 = ___L0;
- int32_t L_55 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_54, 4, /*hidden argument*/NULL);
- V_12 = L_55;
- intptr_t L_56 = ___L0;
- double L_57 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_56, 5, /*hidden argument*/NULL);
- V_13 = (((float)((float)L_57)));
- Transform_t3600365921 * L_58 = V_1;
- Vector3_t3722313464 L_59 = V_10;
- float L_60 = V_11;
- int32_t L_61 = V_12;
- float L_62 = V_13;
- Sequence_t2050373119 * L_63 = ShortcutExtensions_DOJump_m2824502518(NULL /*static, unused*/, L_58, L_59, L_60, L_61, L_62, (bool)0, /*hidden argument*/NULL);
- V_14 = L_63;
- ObjectTranslator_t2020767555 * L_64 = V_0;
- intptr_t L_65 = ___L0;
- Sequence_t2050373119 * L_66 = V_14;
- NullCheck(L_64);
- ObjectTranslator_Push_m105918116(L_64, L_65, L_66, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_016b;
- }
- IL_013f:
- {
- goto IL_015f;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0144;
- throw e;
- }
- CATCH_0144:
- { // begin catch(System.Exception)
- V_15 = ((Exception_t *)__exception_local);
- intptr_t L_67 = ___L0;
- Exception_t * L_68 = V_15;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_69 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_68, /*hidden argument*/NULL);
- int32_t L_70 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_67, L_69, /*hidden argument*/NULL);
- V_9 = L_70;
- goto IL_016b;
- } // end catch (depth: 1)
- IL_015f:
- {
- intptr_t L_71 = ___L0;
- int32_t L_72 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_71, _stringLiteral3400301185, /*hidden argument*/NULL);
- return L_72;
- }
- IL_016b:
- {
- int32_t L_73 = V_9;
- return L_73;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalJump(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalJump_m296616187 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalJump_m296616187_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- bool V_7 = false;
- Sequence_t2050373119 * V_8 = NULL;
- int32_t V_9 = 0;
- Vector3_t3722313464 V_10;
- memset(&V_10, 0, sizeof(V_10));
- float V_11 = 0.0f;
- int32_t V_12 = 0;
- float V_13 = 0.0f;
- Sequence_t2050373119 * V_14 = NULL;
- Exception_t * V_15 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)6))))
- {
- goto IL_00bb;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00bb;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_004f:
- {
- intptr_t L_16 = ___L0;
- int32_t L_17 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_16, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_17) == ((uint32_t)3))))
- {
- goto IL_00bb;
- }
- }
- IL_005c:
- {
- intptr_t L_18 = ___L0;
- int32_t L_19 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_18, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_19) == ((uint32_t)1))))
- {
- goto IL_00bb;
- }
- }
- IL_0069:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- NullCheck(L_20);
- ObjectTranslator_Get_m1627229423(L_20, L_21, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- intptr_t L_24 = ___L0;
- int32_t L_25 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_24, 4, /*hidden argument*/NULL);
- V_5 = L_25;
- intptr_t L_26 = ___L0;
- double L_27 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_26, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_27)));
- intptr_t L_28 = ___L0;
- bool L_29 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_28, 6, /*hidden argument*/NULL);
- V_7 = L_29;
- Transform_t3600365921 * L_30 = V_1;
- Vector3_t3722313464 L_31 = V_3;
- float L_32 = V_4;
- int32_t L_33 = V_5;
- float L_34 = V_6;
- bool L_35 = V_7;
- Sequence_t2050373119 * L_36 = ShortcutExtensions_DOLocalJump_m2308167039(NULL /*static, unused*/, L_30, L_31, L_32, L_33, L_34, L_35, /*hidden argument*/NULL);
- V_8 = L_36;
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- Sequence_t2050373119 * L_39 = V_8;
- NullCheck(L_37);
- ObjectTranslator_Push_m105918116(L_37, L_38, L_39, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_016b;
- }
- IL_00bb:
- {
- int32_t L_40 = V_2;
- if ((!(((uint32_t)L_40) == ((uint32_t)5))))
- {
- goto IL_013f;
- }
- }
- IL_00c2:
- {
- ObjectTranslator_t2020767555 * L_41 = V_0;
- intptr_t L_42 = ___L0;
- NullCheck(L_41);
- bool L_43 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_41, L_42, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_43)
- {
- goto IL_013f;
- }
- }
- IL_00cf:
- {
- intptr_t L_44 = ___L0;
- int32_t L_45 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_44, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_45) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00dc:
- {
- intptr_t L_46 = ___L0;
- int32_t L_47 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_46, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_47) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00e9:
- {
- intptr_t L_48 = ___L0;
- int32_t L_49 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_48, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_49) == ((uint32_t)3))))
- {
- goto IL_013f;
- }
- }
- IL_00f6:
- {
- ObjectTranslator_t2020767555 * L_50 = V_0;
- intptr_t L_51 = ___L0;
- NullCheck(L_50);
- ObjectTranslator_Get_m1627229423(L_50, L_51, 2, (&V_10), /*hidden argument*/NULL);
- intptr_t L_52 = ___L0;
- double L_53 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_52, 3, /*hidden argument*/NULL);
- V_11 = (((float)((float)L_53)));
- intptr_t L_54 = ___L0;
- int32_t L_55 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_54, 4, /*hidden argument*/NULL);
- V_12 = L_55;
- intptr_t L_56 = ___L0;
- double L_57 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_56, 5, /*hidden argument*/NULL);
- V_13 = (((float)((float)L_57)));
- Transform_t3600365921 * L_58 = V_1;
- Vector3_t3722313464 L_59 = V_10;
- float L_60 = V_11;
- int32_t L_61 = V_12;
- float L_62 = V_13;
- Sequence_t2050373119 * L_63 = ShortcutExtensions_DOLocalJump_m2308167039(NULL /*static, unused*/, L_58, L_59, L_60, L_61, L_62, (bool)0, /*hidden argument*/NULL);
- V_14 = L_63;
- ObjectTranslator_t2020767555 * L_64 = V_0;
- intptr_t L_65 = ___L0;
- Sequence_t2050373119 * L_66 = V_14;
- NullCheck(L_64);
- ObjectTranslator_Push_m105918116(L_64, L_65, L_66, /*hidden argument*/NULL);
- V_9 = 1;
- goto IL_016b;
- }
- IL_013f:
- {
- goto IL_015f;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0144;
- throw e;
- }
- CATCH_0144:
- { // begin catch(System.Exception)
- V_15 = ((Exception_t *)__exception_local);
- intptr_t L_67 = ___L0;
- Exception_t * L_68 = V_15;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_69 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_68, /*hidden argument*/NULL);
- int32_t L_70 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_67, L_69, /*hidden argument*/NULL);
- V_9 = L_70;
- goto IL_016b;
- } // end catch (depth: 1)
- IL_015f:
- {
- intptr_t L_71 = ___L0;
- int32_t L_72 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_71, _stringLiteral2365651477, /*hidden argument*/NULL);
- return L_72;
- }
- IL_016b:
- {
- int32_t L_73 = V_9;
- return L_73;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOPath(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOPath_m2509685622 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOPath_m2509685622_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Path_t3614338981 * V_3 = NULL;
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- TweenerCore_3_t3040139253 * V_6 = NULL;
- int32_t V_7 = 0;
- Path_t3614338981 * V_8 = NULL;
- float V_9 = 0.0f;
- TweenerCore_3_t3040139253 * V_10 = NULL;
- Vector3U5BU5D_t1718750761* V_11 = NULL;
- float V_12 = 0.0f;
- int32_t V_13 = 0;
- int32_t V_14 = 0;
- int32_t V_15 = 0;
- Nullable_1_t4278248406 V_16;
- memset(&V_16, 0, sizeof(V_16));
- TweenerCore_3_t3040139253 * V_17 = NULL;
- Vector3U5BU5D_t1718750761* V_18 = NULL;
- float V_19 = 0.0f;
- int32_t V_20 = 0;
- int32_t V_21 = 0;
- int32_t V_22 = 0;
- TweenerCore_3_t3040139253 * V_23 = NULL;
- Nullable_1_t4278248406 V_24;
- memset(&V_24, 0, sizeof(V_24));
- Vector3U5BU5D_t1718750761* V_25 = NULL;
- float V_26 = 0.0f;
- int32_t V_27 = 0;
- int32_t V_28 = 0;
- TweenerCore_3_t3040139253 * V_29 = NULL;
- Vector3U5BU5D_t1718750761* V_30 = NULL;
- float V_31 = 0.0f;
- int32_t V_32 = 0;
- TweenerCore_3_t3040139253 * V_33 = NULL;
- Vector3U5BU5D_t1718750761* V_34 = NULL;
- float V_35 = 0.0f;
- TweenerCore_3_t3040139253 * V_36 = NULL;
- Exception_t * V_37 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0099;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_0099;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_0099;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_0099;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- RuntimeTypeHandle_t3027515415 L_19 = { reinterpret_cast<intptr_t> (Path_t3614338981_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_20 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_19, /*hidden argument*/NULL);
- NullCheck(L_17);
- RuntimeObject * L_21 = ObjectTranslator_GetObject_m805173647(L_17, L_18, 2, L_20, /*hidden argument*/NULL);
- V_3 = ((Path_t3614338981 *)CastclassClass((RuntimeObject*)L_21, Path_t3614338981_il2cpp_TypeInfo_var));
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- ObjectTranslator_t2020767555 * L_24 = V_0;
- intptr_t L_25 = ___L0;
- NullCheck(L_24);
- ObjectTranslator_Get_m2906801996(L_24, L_25, 4, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_26 = V_1;
- Path_t3614338981 * L_27 = V_3;
- float L_28 = V_4;
- int32_t L_29 = V_5;
- TweenerCore_3_t3040139253 * L_30 = ShortcutExtensions_DOPath_m1737185059(NULL /*static, unused*/, L_26, L_27, L_28, L_29, /*hidden argument*/NULL);
- V_6 = L_30;
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- TweenerCore_3_t3040139253 * L_33 = V_6;
- NullCheck(L_31);
- ObjectTranslator_Push_m105918116(L_31, L_32, L_33, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0099:
- {
- int32_t L_34 = V_2;
- if ((!(((uint32_t)L_34) == ((uint32_t)3))))
- {
- goto IL_00fb;
- }
- }
- IL_00a0:
- {
- ObjectTranslator_t2020767555 * L_35 = V_0;
- intptr_t L_36 = ___L0;
- NullCheck(L_35);
- bool L_37 = ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919(L_35, L_36, 2, /*hidden argument*/ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919_RuntimeMethod_var);
- if (!L_37)
- {
- goto IL_00fb;
- }
- }
- IL_00ad:
- {
- intptr_t L_38 = ___L0;
- int32_t L_39 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_38, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_39) == ((uint32_t)3))))
- {
- goto IL_00fb;
- }
- }
- IL_00ba:
- {
- ObjectTranslator_t2020767555 * L_40 = V_0;
- intptr_t L_41 = ___L0;
- RuntimeTypeHandle_t3027515415 L_42 = { reinterpret_cast<intptr_t> (Path_t3614338981_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_43 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_42, /*hidden argument*/NULL);
- NullCheck(L_40);
- RuntimeObject * L_44 = ObjectTranslator_GetObject_m805173647(L_40, L_41, 2, L_43, /*hidden argument*/NULL);
- V_8 = ((Path_t3614338981 *)CastclassClass((RuntimeObject*)L_44, Path_t3614338981_il2cpp_TypeInfo_var));
- intptr_t L_45 = ___L0;
- double L_46 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_45, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_46)));
- Transform_t3600365921 * L_47 = V_1;
- Path_t3614338981 * L_48 = V_8;
- float L_49 = V_9;
- TweenerCore_3_t3040139253 * L_50 = ShortcutExtensions_DOPath_m1737185059(NULL /*static, unused*/, L_47, L_48, L_49, 1, /*hidden argument*/NULL);
- V_10 = L_50;
- ObjectTranslator_t2020767555 * L_51 = V_0;
- intptr_t L_52 = ___L0;
- TweenerCore_3_t3040139253 * L_53 = V_10;
- NullCheck(L_51);
- ObjectTranslator_Push_m105918116(L_51, L_52, L_53, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_00fb:
- {
- int32_t L_54 = V_2;
- if ((!(((uint32_t)L_54) == ((uint32_t)7))))
- {
- goto IL_01bf;
- }
- }
- IL_0102:
- {
- ObjectTranslator_t2020767555 * L_55 = V_0;
- intptr_t L_56 = ___L0;
- NullCheck(L_55);
- bool L_57 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_55, L_56, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_57)
- {
- goto IL_01bf;
- }
- }
- IL_010f:
- {
- intptr_t L_58 = ___L0;
- int32_t L_59 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_58, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_59) == ((uint32_t)3))))
- {
- goto IL_01bf;
- }
- }
- IL_011c:
- {
- ObjectTranslator_t2020767555 * L_60 = V_0;
- intptr_t L_61 = ___L0;
- NullCheck(L_60);
- bool L_62 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_60, L_61, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_62)
- {
- goto IL_01bf;
- }
- }
- IL_0129:
- {
- ObjectTranslator_t2020767555 * L_63 = V_0;
- intptr_t L_64 = ___L0;
- NullCheck(L_63);
- bool L_65 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_63, L_64, 5, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_65)
- {
- goto IL_01bf;
- }
- }
- IL_0136:
- {
- intptr_t L_66 = ___L0;
- int32_t L_67 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_66, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_67) == ((uint32_t)3))))
- {
- goto IL_01bf;
- }
- }
- IL_0143:
- {
- ObjectTranslator_t2020767555 * L_68 = V_0;
- intptr_t L_69 = ___L0;
- NullCheck(L_68);
- bool L_70 = ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576(L_68, L_69, 7, /*hidden argument*/ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576_RuntimeMethod_var);
- if (!L_70)
- {
- goto IL_01bf;
- }
- }
- IL_0150:
- {
- ObjectTranslator_t2020767555 * L_71 = V_0;
- intptr_t L_72 = ___L0;
- RuntimeTypeHandle_t3027515415 L_73 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_74 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_73, /*hidden argument*/NULL);
- NullCheck(L_71);
- RuntimeObject * L_75 = ObjectTranslator_GetObject_m805173647(L_71, L_72, 2, L_74, /*hidden argument*/NULL);
- V_11 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_75, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_76 = ___L0;
- double L_77 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_76, 3, /*hidden argument*/NULL);
- V_12 = (((float)((float)L_77)));
- ObjectTranslator_t2020767555 * L_78 = V_0;
- intptr_t L_79 = ___L0;
- NullCheck(L_78);
- ObjectTranslator_Get_m3757128783(L_78, L_79, 4, (&V_13), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_80 = V_0;
- intptr_t L_81 = ___L0;
- NullCheck(L_80);
- ObjectTranslator_Get_m2906801996(L_80, L_81, 5, (&V_14), /*hidden argument*/NULL);
- intptr_t L_82 = ___L0;
- int32_t L_83 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_82, 6, /*hidden argument*/NULL);
- V_15 = L_83;
- ObjectTranslator_t2020767555 * L_84 = V_0;
- intptr_t L_85 = ___L0;
- NullCheck(L_84);
- ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195(L_84, L_85, 7, (&V_16), /*hidden argument*/ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195_RuntimeMethod_var);
- Transform_t3600365921 * L_86 = V_1;
- Vector3U5BU5D_t1718750761* L_87 = V_11;
- float L_88 = V_12;
- int32_t L_89 = V_13;
- int32_t L_90 = V_14;
- int32_t L_91 = V_15;
- Nullable_1_t4278248406 L_92 = V_16;
- TweenerCore_3_t3040139253 * L_93 = ShortcutExtensions_DOPath_m1170749557(NULL /*static, unused*/, L_86, L_87, L_88, L_89, L_90, L_91, L_92, /*hidden argument*/NULL);
- V_17 = L_93;
- ObjectTranslator_t2020767555 * L_94 = V_0;
- intptr_t L_95 = ___L0;
- TweenerCore_3_t3040139253 * L_96 = V_17;
- NullCheck(L_94);
- ObjectTranslator_Push_m105918116(L_94, L_95, L_96, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_01bf:
- {
- int32_t L_97 = V_2;
- if ((!(((uint32_t)L_97) == ((uint32_t)6))))
- {
- goto IL_0274;
- }
- }
- IL_01c6:
- {
- ObjectTranslator_t2020767555 * L_98 = V_0;
- intptr_t L_99 = ___L0;
- NullCheck(L_98);
- bool L_100 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_98, L_99, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_100)
- {
- goto IL_0274;
- }
- }
- IL_01d3:
- {
- intptr_t L_101 = ___L0;
- int32_t L_102 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_101, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_102) == ((uint32_t)3))))
- {
- goto IL_0274;
- }
- }
- IL_01e0:
- {
- ObjectTranslator_t2020767555 * L_103 = V_0;
- intptr_t L_104 = ___L0;
- NullCheck(L_103);
- bool L_105 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_103, L_104, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_105)
- {
- goto IL_0274;
- }
- }
- IL_01ed:
- {
- ObjectTranslator_t2020767555 * L_106 = V_0;
- intptr_t L_107 = ___L0;
- NullCheck(L_106);
- bool L_108 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_106, L_107, 5, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_108)
- {
- goto IL_0274;
- }
- }
- IL_01fa:
- {
- intptr_t L_109 = ___L0;
- int32_t L_110 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_109, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_110) == ((uint32_t)3))))
- {
- goto IL_0274;
- }
- }
- IL_0207:
- {
- ObjectTranslator_t2020767555 * L_111 = V_0;
- intptr_t L_112 = ___L0;
- RuntimeTypeHandle_t3027515415 L_113 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_114 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_113, /*hidden argument*/NULL);
- NullCheck(L_111);
- RuntimeObject * L_115 = ObjectTranslator_GetObject_m805173647(L_111, L_112, 2, L_114, /*hidden argument*/NULL);
- V_18 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_115, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_116 = ___L0;
- double L_117 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_116, 3, /*hidden argument*/NULL);
- V_19 = (((float)((float)L_117)));
- ObjectTranslator_t2020767555 * L_118 = V_0;
- intptr_t L_119 = ___L0;
- NullCheck(L_118);
- ObjectTranslator_Get_m3757128783(L_118, L_119, 4, (&V_20), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_120 = V_0;
- intptr_t L_121 = ___L0;
- NullCheck(L_120);
- ObjectTranslator_Get_m2906801996(L_120, L_121, 5, (&V_21), /*hidden argument*/NULL);
- intptr_t L_122 = ___L0;
- int32_t L_123 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_122, 6, /*hidden argument*/NULL);
- V_22 = L_123;
- Transform_t3600365921 * L_124 = V_1;
- Vector3U5BU5D_t1718750761* L_125 = V_18;
- float L_126 = V_19;
- int32_t L_127 = V_20;
- int32_t L_128 = V_21;
- int32_t L_129 = V_22;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_130 = V_24;
- TweenerCore_3_t3040139253 * L_131 = ShortcutExtensions_DOPath_m1170749557(NULL /*static, unused*/, L_124, L_125, L_126, L_127, L_128, L_129, L_130, /*hidden argument*/NULL);
- V_23 = L_131;
- ObjectTranslator_t2020767555 * L_132 = V_0;
- intptr_t L_133 = ___L0;
- TweenerCore_3_t3040139253 * L_134 = V_23;
- NullCheck(L_132);
- ObjectTranslator_Push_m105918116(L_132, L_133, L_134, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0274:
- {
- int32_t L_135 = V_2;
- if ((!(((uint32_t)L_135) == ((uint32_t)5))))
- {
- goto IL_0313;
- }
- }
- IL_027b:
- {
- ObjectTranslator_t2020767555 * L_136 = V_0;
- intptr_t L_137 = ___L0;
- NullCheck(L_136);
- bool L_138 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_136, L_137, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_138)
- {
- goto IL_0313;
- }
- }
- IL_0288:
- {
- intptr_t L_139 = ___L0;
- int32_t L_140 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_139, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_140) == ((uint32_t)3))))
- {
- goto IL_0313;
- }
- }
- IL_0295:
- {
- ObjectTranslator_t2020767555 * L_141 = V_0;
- intptr_t L_142 = ___L0;
- NullCheck(L_141);
- bool L_143 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_141, L_142, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_143)
- {
- goto IL_0313;
- }
- }
- IL_02a2:
- {
- ObjectTranslator_t2020767555 * L_144 = V_0;
- intptr_t L_145 = ___L0;
- NullCheck(L_144);
- bool L_146 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_144, L_145, 5, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_146)
- {
- goto IL_0313;
- }
- }
- IL_02af:
- {
- ObjectTranslator_t2020767555 * L_147 = V_0;
- intptr_t L_148 = ___L0;
- RuntimeTypeHandle_t3027515415 L_149 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_150 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_149, /*hidden argument*/NULL);
- NullCheck(L_147);
- RuntimeObject * L_151 = ObjectTranslator_GetObject_m805173647(L_147, L_148, 2, L_150, /*hidden argument*/NULL);
- V_25 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_151, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_152 = ___L0;
- double L_153 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_152, 3, /*hidden argument*/NULL);
- V_26 = (((float)((float)L_153)));
- ObjectTranslator_t2020767555 * L_154 = V_0;
- intptr_t L_155 = ___L0;
- NullCheck(L_154);
- ObjectTranslator_Get_m3757128783(L_154, L_155, 4, (&V_27), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_156 = V_0;
- intptr_t L_157 = ___L0;
- NullCheck(L_156);
- ObjectTranslator_Get_m2906801996(L_156, L_157, 5, (&V_28), /*hidden argument*/NULL);
- Transform_t3600365921 * L_158 = V_1;
- Vector3U5BU5D_t1718750761* L_159 = V_25;
- float L_160 = V_26;
- int32_t L_161 = V_27;
- int32_t L_162 = V_28;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_163 = V_24;
- TweenerCore_3_t3040139253 * L_164 = ShortcutExtensions_DOPath_m1170749557(NULL /*static, unused*/, L_158, L_159, L_160, L_161, L_162, ((int32_t)10), L_163, /*hidden argument*/NULL);
- V_29 = L_164;
- ObjectTranslator_t2020767555 * L_165 = V_0;
- intptr_t L_166 = ___L0;
- TweenerCore_3_t3040139253 * L_167 = V_29;
- NullCheck(L_165);
- ObjectTranslator_Push_m105918116(L_165, L_166, L_167, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0313:
- {
- int32_t L_168 = V_2;
- if ((!(((uint32_t)L_168) == ((uint32_t)4))))
- {
- goto IL_039a;
- }
- }
- IL_031a:
- {
- ObjectTranslator_t2020767555 * L_169 = V_0;
- intptr_t L_170 = ___L0;
- NullCheck(L_169);
- bool L_171 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_169, L_170, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_171)
- {
- goto IL_039a;
- }
- }
- IL_0327:
- {
- intptr_t L_172 = ___L0;
- int32_t L_173 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_172, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_173) == ((uint32_t)3))))
- {
- goto IL_039a;
- }
- }
- IL_0334:
- {
- ObjectTranslator_t2020767555 * L_174 = V_0;
- intptr_t L_175 = ___L0;
- NullCheck(L_174);
- bool L_176 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_174, L_175, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_176)
- {
- goto IL_039a;
- }
- }
- IL_0341:
- {
- ObjectTranslator_t2020767555 * L_177 = V_0;
- intptr_t L_178 = ___L0;
- RuntimeTypeHandle_t3027515415 L_179 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_180 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_179, /*hidden argument*/NULL);
- NullCheck(L_177);
- RuntimeObject * L_181 = ObjectTranslator_GetObject_m805173647(L_177, L_178, 2, L_180, /*hidden argument*/NULL);
- V_30 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_181, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_182 = ___L0;
- double L_183 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_182, 3, /*hidden argument*/NULL);
- V_31 = (((float)((float)L_183)));
- ObjectTranslator_t2020767555 * L_184 = V_0;
- intptr_t L_185 = ___L0;
- NullCheck(L_184);
- ObjectTranslator_Get_m3757128783(L_184, L_185, 4, (&V_32), /*hidden argument*/NULL);
- Transform_t3600365921 * L_186 = V_1;
- Vector3U5BU5D_t1718750761* L_187 = V_30;
- float L_188 = V_31;
- int32_t L_189 = V_32;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_190 = V_24;
- TweenerCore_3_t3040139253 * L_191 = ShortcutExtensions_DOPath_m1170749557(NULL /*static, unused*/, L_186, L_187, L_188, L_189, 1, ((int32_t)10), L_190, /*hidden argument*/NULL);
- V_33 = L_191;
- ObjectTranslator_t2020767555 * L_192 = V_0;
- intptr_t L_193 = ___L0;
- TweenerCore_3_t3040139253 * L_194 = V_33;
- NullCheck(L_192);
- ObjectTranslator_Push_m105918116(L_192, L_193, L_194, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_039a:
- {
- int32_t L_195 = V_2;
- if ((!(((uint32_t)L_195) == ((uint32_t)3))))
- {
- goto IL_0409;
- }
- }
- IL_03a1:
- {
- ObjectTranslator_t2020767555 * L_196 = V_0;
- intptr_t L_197 = ___L0;
- NullCheck(L_196);
- bool L_198 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_196, L_197, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_198)
- {
- goto IL_0409;
- }
- }
- IL_03ae:
- {
- intptr_t L_199 = ___L0;
- int32_t L_200 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_199, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_200) == ((uint32_t)3))))
- {
- goto IL_0409;
- }
- }
- IL_03bb:
- {
- ObjectTranslator_t2020767555 * L_201 = V_0;
- intptr_t L_202 = ___L0;
- RuntimeTypeHandle_t3027515415 L_203 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_204 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_203, /*hidden argument*/NULL);
- NullCheck(L_201);
- RuntimeObject * L_205 = ObjectTranslator_GetObject_m805173647(L_201, L_202, 2, L_204, /*hidden argument*/NULL);
- V_34 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_205, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_206 = ___L0;
- double L_207 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_206, 3, /*hidden argument*/NULL);
- V_35 = (((float)((float)L_207)));
- Transform_t3600365921 * L_208 = V_1;
- Vector3U5BU5D_t1718750761* L_209 = V_34;
- float L_210 = V_35;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_211 = V_24;
- TweenerCore_3_t3040139253 * L_212 = ShortcutExtensions_DOPath_m1170749557(NULL /*static, unused*/, L_208, L_209, L_210, 0, 1, ((int32_t)10), L_211, /*hidden argument*/NULL);
- V_36 = L_212;
- ObjectTranslator_t2020767555 * L_213 = V_0;
- intptr_t L_214 = ___L0;
- TweenerCore_3_t3040139253 * L_215 = V_36;
- NullCheck(L_213);
- ObjectTranslator_Push_m105918116(L_213, L_214, L_215, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0409:
- {
- goto IL_0429;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_040e;
- throw e;
- }
- CATCH_040e:
- { // begin catch(System.Exception)
- V_37 = ((Exception_t *)__exception_local);
- intptr_t L_216 = ___L0;
- Exception_t * L_217 = V_37;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_218 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_217, /*hidden argument*/NULL);
- int32_t L_219 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_216, L_218, /*hidden argument*/NULL);
- V_7 = L_219;
- goto IL_0435;
- } // end catch (depth: 1)
- IL_0429:
- {
- intptr_t L_220 = ___L0;
- int32_t L_221 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_220, _stringLiteral2954888021, /*hidden argument*/NULL);
- return L_221;
- }
- IL_0435:
- {
- int32_t L_222 = V_7;
- return L_222;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOLocalPath(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOLocalPath_m442715724 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOLocalPath_m442715724_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Path_t3614338981 * V_3 = NULL;
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- TweenerCore_3_t3040139253 * V_6 = NULL;
- int32_t V_7 = 0;
- Path_t3614338981 * V_8 = NULL;
- float V_9 = 0.0f;
- TweenerCore_3_t3040139253 * V_10 = NULL;
- Vector3U5BU5D_t1718750761* V_11 = NULL;
- float V_12 = 0.0f;
- int32_t V_13 = 0;
- int32_t V_14 = 0;
- int32_t V_15 = 0;
- Nullable_1_t4278248406 V_16;
- memset(&V_16, 0, sizeof(V_16));
- TweenerCore_3_t3040139253 * V_17 = NULL;
- Vector3U5BU5D_t1718750761* V_18 = NULL;
- float V_19 = 0.0f;
- int32_t V_20 = 0;
- int32_t V_21 = 0;
- int32_t V_22 = 0;
- TweenerCore_3_t3040139253 * V_23 = NULL;
- Nullable_1_t4278248406 V_24;
- memset(&V_24, 0, sizeof(V_24));
- Vector3U5BU5D_t1718750761* V_25 = NULL;
- float V_26 = 0.0f;
- int32_t V_27 = 0;
- int32_t V_28 = 0;
- TweenerCore_3_t3040139253 * V_29 = NULL;
- Vector3U5BU5D_t1718750761* V_30 = NULL;
- float V_31 = 0.0f;
- int32_t V_32 = 0;
- TweenerCore_3_t3040139253 * V_33 = NULL;
- Vector3U5BU5D_t1718750761* V_34 = NULL;
- float V_35 = 0.0f;
- TweenerCore_3_t3040139253 * V_36 = NULL;
- Exception_t * V_37 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_0099;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_0099;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_0099;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_0099;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- RuntimeTypeHandle_t3027515415 L_19 = { reinterpret_cast<intptr_t> (Path_t3614338981_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_20 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_19, /*hidden argument*/NULL);
- NullCheck(L_17);
- RuntimeObject * L_21 = ObjectTranslator_GetObject_m805173647(L_17, L_18, 2, L_20, /*hidden argument*/NULL);
- V_3 = ((Path_t3614338981 *)CastclassClass((RuntimeObject*)L_21, Path_t3614338981_il2cpp_TypeInfo_var));
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- ObjectTranslator_t2020767555 * L_24 = V_0;
- intptr_t L_25 = ___L0;
- NullCheck(L_24);
- ObjectTranslator_Get_m2906801996(L_24, L_25, 4, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_26 = V_1;
- Path_t3614338981 * L_27 = V_3;
- float L_28 = V_4;
- int32_t L_29 = V_5;
- TweenerCore_3_t3040139253 * L_30 = ShortcutExtensions_DOLocalPath_m3367906890(NULL /*static, unused*/, L_26, L_27, L_28, L_29, /*hidden argument*/NULL);
- V_6 = L_30;
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- TweenerCore_3_t3040139253 * L_33 = V_6;
- NullCheck(L_31);
- ObjectTranslator_Push_m105918116(L_31, L_32, L_33, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0099:
- {
- int32_t L_34 = V_2;
- if ((!(((uint32_t)L_34) == ((uint32_t)3))))
- {
- goto IL_00fb;
- }
- }
- IL_00a0:
- {
- ObjectTranslator_t2020767555 * L_35 = V_0;
- intptr_t L_36 = ___L0;
- NullCheck(L_35);
- bool L_37 = ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919(L_35, L_36, 2, /*hidden argument*/ObjectTranslator_Assignable_TisPath_t3614338981_m3433527919_RuntimeMethod_var);
- if (!L_37)
- {
- goto IL_00fb;
- }
- }
- IL_00ad:
- {
- intptr_t L_38 = ___L0;
- int32_t L_39 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_38, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_39) == ((uint32_t)3))))
- {
- goto IL_00fb;
- }
- }
- IL_00ba:
- {
- ObjectTranslator_t2020767555 * L_40 = V_0;
- intptr_t L_41 = ___L0;
- RuntimeTypeHandle_t3027515415 L_42 = { reinterpret_cast<intptr_t> (Path_t3614338981_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_43 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_42, /*hidden argument*/NULL);
- NullCheck(L_40);
- RuntimeObject * L_44 = ObjectTranslator_GetObject_m805173647(L_40, L_41, 2, L_43, /*hidden argument*/NULL);
- V_8 = ((Path_t3614338981 *)CastclassClass((RuntimeObject*)L_44, Path_t3614338981_il2cpp_TypeInfo_var));
- intptr_t L_45 = ___L0;
- double L_46 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_45, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_46)));
- Transform_t3600365921 * L_47 = V_1;
- Path_t3614338981 * L_48 = V_8;
- float L_49 = V_9;
- TweenerCore_3_t3040139253 * L_50 = ShortcutExtensions_DOLocalPath_m3367906890(NULL /*static, unused*/, L_47, L_48, L_49, 1, /*hidden argument*/NULL);
- V_10 = L_50;
- ObjectTranslator_t2020767555 * L_51 = V_0;
- intptr_t L_52 = ___L0;
- TweenerCore_3_t3040139253 * L_53 = V_10;
- NullCheck(L_51);
- ObjectTranslator_Push_m105918116(L_51, L_52, L_53, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_00fb:
- {
- int32_t L_54 = V_2;
- if ((!(((uint32_t)L_54) == ((uint32_t)7))))
- {
- goto IL_01bf;
- }
- }
- IL_0102:
- {
- ObjectTranslator_t2020767555 * L_55 = V_0;
- intptr_t L_56 = ___L0;
- NullCheck(L_55);
- bool L_57 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_55, L_56, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_57)
- {
- goto IL_01bf;
- }
- }
- IL_010f:
- {
- intptr_t L_58 = ___L0;
- int32_t L_59 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_58, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_59) == ((uint32_t)3))))
- {
- goto IL_01bf;
- }
- }
- IL_011c:
- {
- ObjectTranslator_t2020767555 * L_60 = V_0;
- intptr_t L_61 = ___L0;
- NullCheck(L_60);
- bool L_62 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_60, L_61, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_62)
- {
- goto IL_01bf;
- }
- }
- IL_0129:
- {
- ObjectTranslator_t2020767555 * L_63 = V_0;
- intptr_t L_64 = ___L0;
- NullCheck(L_63);
- bool L_65 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_63, L_64, 5, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_65)
- {
- goto IL_01bf;
- }
- }
- IL_0136:
- {
- intptr_t L_66 = ___L0;
- int32_t L_67 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_66, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_67) == ((uint32_t)3))))
- {
- goto IL_01bf;
- }
- }
- IL_0143:
- {
- ObjectTranslator_t2020767555 * L_68 = V_0;
- intptr_t L_69 = ___L0;
- NullCheck(L_68);
- bool L_70 = ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576(L_68, L_69, 7, /*hidden argument*/ObjectTranslator_Assignable_TisNullable_1_t4278248406_m3012182576_RuntimeMethod_var);
- if (!L_70)
- {
- goto IL_01bf;
- }
- }
- IL_0150:
- {
- ObjectTranslator_t2020767555 * L_71 = V_0;
- intptr_t L_72 = ___L0;
- RuntimeTypeHandle_t3027515415 L_73 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_74 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_73, /*hidden argument*/NULL);
- NullCheck(L_71);
- RuntimeObject * L_75 = ObjectTranslator_GetObject_m805173647(L_71, L_72, 2, L_74, /*hidden argument*/NULL);
- V_11 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_75, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_76 = ___L0;
- double L_77 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_76, 3, /*hidden argument*/NULL);
- V_12 = (((float)((float)L_77)));
- ObjectTranslator_t2020767555 * L_78 = V_0;
- intptr_t L_79 = ___L0;
- NullCheck(L_78);
- ObjectTranslator_Get_m3757128783(L_78, L_79, 4, (&V_13), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_80 = V_0;
- intptr_t L_81 = ___L0;
- NullCheck(L_80);
- ObjectTranslator_Get_m2906801996(L_80, L_81, 5, (&V_14), /*hidden argument*/NULL);
- intptr_t L_82 = ___L0;
- int32_t L_83 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_82, 6, /*hidden argument*/NULL);
- V_15 = L_83;
- ObjectTranslator_t2020767555 * L_84 = V_0;
- intptr_t L_85 = ___L0;
- NullCheck(L_84);
- ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195(L_84, L_85, 7, (&V_16), /*hidden argument*/ObjectTranslator_Get_TisNullable_1_t4278248406_m1997935195_RuntimeMethod_var);
- Transform_t3600365921 * L_86 = V_1;
- Vector3U5BU5D_t1718750761* L_87 = V_11;
- float L_88 = V_12;
- int32_t L_89 = V_13;
- int32_t L_90 = V_14;
- int32_t L_91 = V_15;
- Nullable_1_t4278248406 L_92 = V_16;
- TweenerCore_3_t3040139253 * L_93 = ShortcutExtensions_DOLocalPath_m3183460192(NULL /*static, unused*/, L_86, L_87, L_88, L_89, L_90, L_91, L_92, /*hidden argument*/NULL);
- V_17 = L_93;
- ObjectTranslator_t2020767555 * L_94 = V_0;
- intptr_t L_95 = ___L0;
- TweenerCore_3_t3040139253 * L_96 = V_17;
- NullCheck(L_94);
- ObjectTranslator_Push_m105918116(L_94, L_95, L_96, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_01bf:
- {
- int32_t L_97 = V_2;
- if ((!(((uint32_t)L_97) == ((uint32_t)6))))
- {
- goto IL_0274;
- }
- }
- IL_01c6:
- {
- ObjectTranslator_t2020767555 * L_98 = V_0;
- intptr_t L_99 = ___L0;
- NullCheck(L_98);
- bool L_100 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_98, L_99, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_100)
- {
- goto IL_0274;
- }
- }
- IL_01d3:
- {
- intptr_t L_101 = ___L0;
- int32_t L_102 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_101, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_102) == ((uint32_t)3))))
- {
- goto IL_0274;
- }
- }
- IL_01e0:
- {
- ObjectTranslator_t2020767555 * L_103 = V_0;
- intptr_t L_104 = ___L0;
- NullCheck(L_103);
- bool L_105 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_103, L_104, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_105)
- {
- goto IL_0274;
- }
- }
- IL_01ed:
- {
- ObjectTranslator_t2020767555 * L_106 = V_0;
- intptr_t L_107 = ___L0;
- NullCheck(L_106);
- bool L_108 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_106, L_107, 5, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_108)
- {
- goto IL_0274;
- }
- }
- IL_01fa:
- {
- intptr_t L_109 = ___L0;
- int32_t L_110 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_109, 6, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_110) == ((uint32_t)3))))
- {
- goto IL_0274;
- }
- }
- IL_0207:
- {
- ObjectTranslator_t2020767555 * L_111 = V_0;
- intptr_t L_112 = ___L0;
- RuntimeTypeHandle_t3027515415 L_113 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_114 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_113, /*hidden argument*/NULL);
- NullCheck(L_111);
- RuntimeObject * L_115 = ObjectTranslator_GetObject_m805173647(L_111, L_112, 2, L_114, /*hidden argument*/NULL);
- V_18 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_115, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_116 = ___L0;
- double L_117 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_116, 3, /*hidden argument*/NULL);
- V_19 = (((float)((float)L_117)));
- ObjectTranslator_t2020767555 * L_118 = V_0;
- intptr_t L_119 = ___L0;
- NullCheck(L_118);
- ObjectTranslator_Get_m3757128783(L_118, L_119, 4, (&V_20), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_120 = V_0;
- intptr_t L_121 = ___L0;
- NullCheck(L_120);
- ObjectTranslator_Get_m2906801996(L_120, L_121, 5, (&V_21), /*hidden argument*/NULL);
- intptr_t L_122 = ___L0;
- int32_t L_123 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_122, 6, /*hidden argument*/NULL);
- V_22 = L_123;
- Transform_t3600365921 * L_124 = V_1;
- Vector3U5BU5D_t1718750761* L_125 = V_18;
- float L_126 = V_19;
- int32_t L_127 = V_20;
- int32_t L_128 = V_21;
- int32_t L_129 = V_22;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_130 = V_24;
- TweenerCore_3_t3040139253 * L_131 = ShortcutExtensions_DOLocalPath_m3183460192(NULL /*static, unused*/, L_124, L_125, L_126, L_127, L_128, L_129, L_130, /*hidden argument*/NULL);
- V_23 = L_131;
- ObjectTranslator_t2020767555 * L_132 = V_0;
- intptr_t L_133 = ___L0;
- TweenerCore_3_t3040139253 * L_134 = V_23;
- NullCheck(L_132);
- ObjectTranslator_Push_m105918116(L_132, L_133, L_134, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0274:
- {
- int32_t L_135 = V_2;
- if ((!(((uint32_t)L_135) == ((uint32_t)5))))
- {
- goto IL_0313;
- }
- }
- IL_027b:
- {
- ObjectTranslator_t2020767555 * L_136 = V_0;
- intptr_t L_137 = ___L0;
- NullCheck(L_136);
- bool L_138 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_136, L_137, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_138)
- {
- goto IL_0313;
- }
- }
- IL_0288:
- {
- intptr_t L_139 = ___L0;
- int32_t L_140 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_139, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_140) == ((uint32_t)3))))
- {
- goto IL_0313;
- }
- }
- IL_0295:
- {
- ObjectTranslator_t2020767555 * L_141 = V_0;
- intptr_t L_142 = ___L0;
- NullCheck(L_141);
- bool L_143 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_141, L_142, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_143)
- {
- goto IL_0313;
- }
- }
- IL_02a2:
- {
- ObjectTranslator_t2020767555 * L_144 = V_0;
- intptr_t L_145 = ___L0;
- NullCheck(L_144);
- bool L_146 = ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943(L_144, L_145, 5, /*hidden argument*/ObjectTranslator_Assignable_TisPathMode_t2165603100_m2079517943_RuntimeMethod_var);
- if (!L_146)
- {
- goto IL_0313;
- }
- }
- IL_02af:
- {
- ObjectTranslator_t2020767555 * L_147 = V_0;
- intptr_t L_148 = ___L0;
- RuntimeTypeHandle_t3027515415 L_149 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_150 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_149, /*hidden argument*/NULL);
- NullCheck(L_147);
- RuntimeObject * L_151 = ObjectTranslator_GetObject_m805173647(L_147, L_148, 2, L_150, /*hidden argument*/NULL);
- V_25 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_151, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_152 = ___L0;
- double L_153 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_152, 3, /*hidden argument*/NULL);
- V_26 = (((float)((float)L_153)));
- ObjectTranslator_t2020767555 * L_154 = V_0;
- intptr_t L_155 = ___L0;
- NullCheck(L_154);
- ObjectTranslator_Get_m3757128783(L_154, L_155, 4, (&V_27), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_156 = V_0;
- intptr_t L_157 = ___L0;
- NullCheck(L_156);
- ObjectTranslator_Get_m2906801996(L_156, L_157, 5, (&V_28), /*hidden argument*/NULL);
- Transform_t3600365921 * L_158 = V_1;
- Vector3U5BU5D_t1718750761* L_159 = V_25;
- float L_160 = V_26;
- int32_t L_161 = V_27;
- int32_t L_162 = V_28;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_163 = V_24;
- TweenerCore_3_t3040139253 * L_164 = ShortcutExtensions_DOLocalPath_m3183460192(NULL /*static, unused*/, L_158, L_159, L_160, L_161, L_162, ((int32_t)10), L_163, /*hidden argument*/NULL);
- V_29 = L_164;
- ObjectTranslator_t2020767555 * L_165 = V_0;
- intptr_t L_166 = ___L0;
- TweenerCore_3_t3040139253 * L_167 = V_29;
- NullCheck(L_165);
- ObjectTranslator_Push_m105918116(L_165, L_166, L_167, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0313:
- {
- int32_t L_168 = V_2;
- if ((!(((uint32_t)L_168) == ((uint32_t)4))))
- {
- goto IL_039a;
- }
- }
- IL_031a:
- {
- ObjectTranslator_t2020767555 * L_169 = V_0;
- intptr_t L_170 = ___L0;
- NullCheck(L_169);
- bool L_171 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_169, L_170, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_171)
- {
- goto IL_039a;
- }
- }
- IL_0327:
- {
- intptr_t L_172 = ___L0;
- int32_t L_173 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_172, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_173) == ((uint32_t)3))))
- {
- goto IL_039a;
- }
- }
- IL_0334:
- {
- ObjectTranslator_t2020767555 * L_174 = V_0;
- intptr_t L_175 = ___L0;
- NullCheck(L_174);
- bool L_176 = ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527(L_174, L_175, 4, /*hidden argument*/ObjectTranslator_Assignable_TisPathType_t3777299409_m1974206527_RuntimeMethod_var);
- if (!L_176)
- {
- goto IL_039a;
- }
- }
- IL_0341:
- {
- ObjectTranslator_t2020767555 * L_177 = V_0;
- intptr_t L_178 = ___L0;
- RuntimeTypeHandle_t3027515415 L_179 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_180 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_179, /*hidden argument*/NULL);
- NullCheck(L_177);
- RuntimeObject * L_181 = ObjectTranslator_GetObject_m805173647(L_177, L_178, 2, L_180, /*hidden argument*/NULL);
- V_30 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_181, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_182 = ___L0;
- double L_183 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_182, 3, /*hidden argument*/NULL);
- V_31 = (((float)((float)L_183)));
- ObjectTranslator_t2020767555 * L_184 = V_0;
- intptr_t L_185 = ___L0;
- NullCheck(L_184);
- ObjectTranslator_Get_m3757128783(L_184, L_185, 4, (&V_32), /*hidden argument*/NULL);
- Transform_t3600365921 * L_186 = V_1;
- Vector3U5BU5D_t1718750761* L_187 = V_30;
- float L_188 = V_31;
- int32_t L_189 = V_32;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_190 = V_24;
- TweenerCore_3_t3040139253 * L_191 = ShortcutExtensions_DOLocalPath_m3183460192(NULL /*static, unused*/, L_186, L_187, L_188, L_189, 1, ((int32_t)10), L_190, /*hidden argument*/NULL);
- V_33 = L_191;
- ObjectTranslator_t2020767555 * L_192 = V_0;
- intptr_t L_193 = ___L0;
- TweenerCore_3_t3040139253 * L_194 = V_33;
- NullCheck(L_192);
- ObjectTranslator_Push_m105918116(L_192, L_193, L_194, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_039a:
- {
- int32_t L_195 = V_2;
- if ((!(((uint32_t)L_195) == ((uint32_t)3))))
- {
- goto IL_0409;
- }
- }
- IL_03a1:
- {
- ObjectTranslator_t2020767555 * L_196 = V_0;
- intptr_t L_197 = ___L0;
- NullCheck(L_196);
- bool L_198 = ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464(L_196, L_197, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3U5BU5D_t1718750761_m1588734464_RuntimeMethod_var);
- if (!L_198)
- {
- goto IL_0409;
- }
- }
- IL_03ae:
- {
- intptr_t L_199 = ___L0;
- int32_t L_200 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_199, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_200) == ((uint32_t)3))))
- {
- goto IL_0409;
- }
- }
- IL_03bb:
- {
- ObjectTranslator_t2020767555 * L_201 = V_0;
- intptr_t L_202 = ___L0;
- RuntimeTypeHandle_t3027515415 L_203 = { reinterpret_cast<intptr_t> (Vector3U5BU5D_t1718750761_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_204 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_203, /*hidden argument*/NULL);
- NullCheck(L_201);
- RuntimeObject * L_205 = ObjectTranslator_GetObject_m805173647(L_201, L_202, 2, L_204, /*hidden argument*/NULL);
- V_34 = ((Vector3U5BU5D_t1718750761*)Castclass((RuntimeObject*)L_205, Vector3U5BU5D_t1718750761_il2cpp_TypeInfo_var));
- intptr_t L_206 = ___L0;
- double L_207 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_206, 3, /*hidden argument*/NULL);
- V_35 = (((float)((float)L_207)));
- Transform_t3600365921 * L_208 = V_1;
- Vector3U5BU5D_t1718750761* L_209 = V_34;
- float L_210 = V_35;
- il2cpp_codegen_initobj((&V_24), sizeof(Nullable_1_t4278248406 ));
- Nullable_1_t4278248406 L_211 = V_24;
- TweenerCore_3_t3040139253 * L_212 = ShortcutExtensions_DOLocalPath_m3183460192(NULL /*static, unused*/, L_208, L_209, L_210, 0, 1, ((int32_t)10), L_211, /*hidden argument*/NULL);
- V_36 = L_212;
- ObjectTranslator_t2020767555 * L_213 = V_0;
- intptr_t L_214 = ___L0;
- TweenerCore_3_t3040139253 * L_215 = V_36;
- NullCheck(L_213);
- ObjectTranslator_Push_m105918116(L_213, L_214, L_215, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0435;
- }
- IL_0409:
- {
- goto IL_0429;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_040e;
- throw e;
- }
- CATCH_040e:
- { // begin catch(System.Exception)
- V_37 = ((Exception_t *)__exception_local);
- intptr_t L_216 = ___L0;
- Exception_t * L_217 = V_37;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_218 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_217, /*hidden argument*/NULL);
- int32_t L_219 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_216, L_218, /*hidden argument*/NULL);
- V_7 = L_219;
- goto IL_0435;
- } // end catch (depth: 1)
- IL_0429:
- {
- intptr_t L_220 = ___L0;
- int32_t L_221 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_220, _stringLiteral2763411632, /*hidden argument*/NULL);
- return L_221;
- }
- IL_0435:
- {
- int32_t L_222 = V_7;
- return L_222;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableMoveBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOBlendableMoveBy_m3858010954_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- bool V_5 = false;
- Tweener_t436044680 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- Tweener_t436044680 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)1))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_16 = V_0;
- intptr_t L_17 = ___L0;
- NullCheck(L_16);
- ObjectTranslator_Get_m1627229423(L_16, L_17, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- double L_19 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_18, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_19)));
- intptr_t L_20 = ___L0;
- bool L_21 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_20, 4, /*hidden argument*/NULL);
- V_5 = L_21;
- Transform_t3600365921 * L_22 = V_1;
- Vector3_t3722313464 L_23 = V_3;
- float L_24 = V_4;
- bool L_25 = V_5;
- Tweener_t436044680 * L_26 = ShortcutExtensions_DOBlendableMoveBy_m533616323(NULL /*static, unused*/, L_22, L_23, L_24, L_25, /*hidden argument*/NULL);
- V_6 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- Tweener_t436044680 * L_29 = V_6;
- NullCheck(L_27);
- ObjectTranslator_Push_m105918116(L_27, L_28, L_29, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_008a:
- {
- int32_t L_30 = V_2;
- if ((!(((uint32_t)L_30) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- NullCheck(L_31);
- bool L_33 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_31, L_32, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_33)
- {
- goto IL_00dd;
- }
- }
- IL_009e:
- {
- intptr_t L_34 = ___L0;
- int32_t L_35 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_34, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_35) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_00ab:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- ObjectTranslator_Get_m1627229423(L_36, L_37, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- double L_39 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_38, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_39)));
- Transform_t3600365921 * L_40 = V_1;
- Vector3_t3722313464 L_41 = V_8;
- float L_42 = V_9;
- Tweener_t436044680 * L_43 = ShortcutExtensions_DOBlendableMoveBy_m533616323(NULL /*static, unused*/, L_40, L_41, L_42, (bool)0, /*hidden argument*/NULL);
- V_10 = L_43;
- ObjectTranslator_t2020767555 * L_44 = V_0;
- intptr_t L_45 = ___L0;
- Tweener_t436044680 * L_46 = V_10;
- NullCheck(L_44);
- ObjectTranslator_Push_m105918116(L_44, L_45, L_46, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_00dd:
- {
- goto IL_00fd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e2;
- throw e;
- }
- CATCH_00e2:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_47 = ___L0;
- Exception_t * L_48 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_49 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_48, /*hidden argument*/NULL);
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_47, L_49, /*hidden argument*/NULL);
- V_7 = L_50;
- goto IL_0109;
- } // end catch (depth: 1)
- IL_00fd:
- {
- intptr_t L_51 = ___L0;
- int32_t L_52 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_51, _stringLiteral2799908669, /*hidden argument*/NULL);
- return L_52;
- }
- IL_0109:
- {
- int32_t L_53 = V_7;
- return L_53;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableLocalMoveBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOBlendableLocalMoveBy_m24914229_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- bool V_5 = false;
- Tweener_t436044680 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- Tweener_t436044680 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008a;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008a;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008a;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)1))))
- {
- goto IL_008a;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_16 = V_0;
- intptr_t L_17 = ___L0;
- NullCheck(L_16);
- ObjectTranslator_Get_m1627229423(L_16, L_17, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- double L_19 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_18, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_19)));
- intptr_t L_20 = ___L0;
- bool L_21 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_20, 4, /*hidden argument*/NULL);
- V_5 = L_21;
- Transform_t3600365921 * L_22 = V_1;
- Vector3_t3722313464 L_23 = V_3;
- float L_24 = V_4;
- bool L_25 = V_5;
- Tweener_t436044680 * L_26 = ShortcutExtensions_DOBlendableLocalMoveBy_m150910410(NULL /*static, unused*/, L_22, L_23, L_24, L_25, /*hidden argument*/NULL);
- V_6 = L_26;
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- Tweener_t436044680 * L_29 = V_6;
- NullCheck(L_27);
- ObjectTranslator_Push_m105918116(L_27, L_28, L_29, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_008a:
- {
- int32_t L_30 = V_2;
- if ((!(((uint32_t)L_30) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_0091:
- {
- ObjectTranslator_t2020767555 * L_31 = V_0;
- intptr_t L_32 = ___L0;
- NullCheck(L_31);
- bool L_33 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_31, L_32, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_33)
- {
- goto IL_00dd;
- }
- }
- IL_009e:
- {
- intptr_t L_34 = ___L0;
- int32_t L_35 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_34, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_35) == ((uint32_t)3))))
- {
- goto IL_00dd;
- }
- }
- IL_00ab:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- ObjectTranslator_Get_m1627229423(L_36, L_37, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- double L_39 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_38, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_39)));
- Transform_t3600365921 * L_40 = V_1;
- Vector3_t3722313464 L_41 = V_8;
- float L_42 = V_9;
- Tweener_t436044680 * L_43 = ShortcutExtensions_DOBlendableLocalMoveBy_m150910410(NULL /*static, unused*/, L_40, L_41, L_42, (bool)0, /*hidden argument*/NULL);
- V_10 = L_43;
- ObjectTranslator_t2020767555 * L_44 = V_0;
- intptr_t L_45 = ___L0;
- Tweener_t436044680 * L_46 = V_10;
- NullCheck(L_44);
- ObjectTranslator_Push_m105918116(L_44, L_45, L_46, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_0109;
- }
- IL_00dd:
- {
- goto IL_00fd;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e2;
- throw e;
- }
- CATCH_00e2:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_47 = ___L0;
- Exception_t * L_48 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_49 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_48, /*hidden argument*/NULL);
- int32_t L_50 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_47, L_49, /*hidden argument*/NULL);
- V_7 = L_50;
- goto IL_0109;
- } // end catch (depth: 1)
- IL_00fd:
- {
- intptr_t L_51 = ___L0;
- int32_t L_52 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_51, _stringLiteral392136173, /*hidden argument*/NULL);
- return L_52;
- }
- IL_0109:
- {
- int32_t L_53 = V_7;
- return L_53;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableRotateBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOBlendableRotateBy_m3914847984_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- Tweener_t436044680 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- Tweener_t436044680 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008b;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008b;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008b;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_008b;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- NullCheck(L_17);
- ObjectTranslator_Get_m1627229423(L_17, L_18, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_20)));
- ObjectTranslator_t2020767555 * L_21 = V_0;
- intptr_t L_22 = ___L0;
- NullCheck(L_21);
- ObjectTranslator_Get_m1355366945(L_21, L_22, 4, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_23 = V_1;
- Vector3_t3722313464 L_24 = V_3;
- float L_25 = V_4;
- int32_t L_26 = V_5;
- Tweener_t436044680 * L_27 = ShortcutExtensions_DOBlendableRotateBy_m899197017(NULL /*static, unused*/, L_23, L_24, L_25, L_26, /*hidden argument*/NULL);
- V_6 = L_27;
- ObjectTranslator_t2020767555 * L_28 = V_0;
- intptr_t L_29 = ___L0;
- Tweener_t436044680 * L_30 = V_6;
- NullCheck(L_28);
- ObjectTranslator_Push_m105918116(L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_008b:
- {
- int32_t L_31 = V_2;
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_0092:
- {
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- NullCheck(L_32);
- bool L_34 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_32, L_33, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_34)
- {
- goto IL_00de;
- }
- }
- IL_009f:
- {
- intptr_t L_35 = ___L0;
- int32_t L_36 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_35, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_36) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_00ac:
- {
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- NullCheck(L_37);
- ObjectTranslator_Get_m1627229423(L_37, L_38, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_39 = ___L0;
- double L_40 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_40)));
- Transform_t3600365921 * L_41 = V_1;
- Vector3_t3722313464 L_42 = V_8;
- float L_43 = V_9;
- Tweener_t436044680 * L_44 = ShortcutExtensions_DOBlendableRotateBy_m899197017(NULL /*static, unused*/, L_41, L_42, L_43, 0, /*hidden argument*/NULL);
- V_10 = L_44;
- ObjectTranslator_t2020767555 * L_45 = V_0;
- intptr_t L_46 = ___L0;
- Tweener_t436044680 * L_47 = V_10;
- NullCheck(L_45);
- ObjectTranslator_Push_m105918116(L_45, L_46, L_47, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_00de:
- {
- goto IL_00fe;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e3;
- throw e;
- }
- CATCH_00e3:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_48 = ___L0;
- Exception_t * L_49 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_50 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_49, /*hidden argument*/NULL);
- int32_t L_51 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_48, L_50, /*hidden argument*/NULL);
- V_7 = L_51;
- goto IL_010a;
- } // end catch (depth: 1)
- IL_00fe:
- {
- intptr_t L_52 = ___L0;
- int32_t L_53 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_52, _stringLiteral2408300189, /*hidden argument*/NULL);
- return L_53;
- }
- IL_010a:
- {
- int32_t L_54 = V_7;
- return L_54;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableLocalRotateBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOBlendableLocalRotateBy_m3520474246_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- Tweener_t436044680 * V_6 = NULL;
- int32_t V_7 = 0;
- Vector3_t3722313464 V_8;
- memset(&V_8, 0, sizeof(V_8));
- float V_9 = 0.0f;
- Tweener_t436044680 * V_10 = NULL;
- Exception_t * V_11 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)4))))
- {
- goto IL_008b;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_008b;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_008b;
- }
- }
- IL_0042:
- {
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- NullCheck(L_14);
- bool L_16 = ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732(L_14, L_15, 4, /*hidden argument*/ObjectTranslator_Assignable_TisRotateMode_t2548570174_m1314270732_RuntimeMethod_var);
- if (!L_16)
- {
- goto IL_008b;
- }
- }
- IL_004f:
- {
- ObjectTranslator_t2020767555 * L_17 = V_0;
- intptr_t L_18 = ___L0;
- NullCheck(L_17);
- ObjectTranslator_Get_m1627229423(L_17, L_18, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_19 = ___L0;
- double L_20 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_19, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_20)));
- ObjectTranslator_t2020767555 * L_21 = V_0;
- intptr_t L_22 = ___L0;
- NullCheck(L_21);
- ObjectTranslator_Get_m1355366945(L_21, L_22, 4, (&V_5), /*hidden argument*/NULL);
- Transform_t3600365921 * L_23 = V_1;
- Vector3_t3722313464 L_24 = V_3;
- float L_25 = V_4;
- int32_t L_26 = V_5;
- Tweener_t436044680 * L_27 = ShortcutExtensions_DOBlendableLocalRotateBy_m1249688942(NULL /*static, unused*/, L_23, L_24, L_25, L_26, /*hidden argument*/NULL);
- V_6 = L_27;
- ObjectTranslator_t2020767555 * L_28 = V_0;
- intptr_t L_29 = ___L0;
- Tweener_t436044680 * L_30 = V_6;
- NullCheck(L_28);
- ObjectTranslator_Push_m105918116(L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_008b:
- {
- int32_t L_31 = V_2;
- if ((!(((uint32_t)L_31) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_0092:
- {
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- NullCheck(L_32);
- bool L_34 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_32, L_33, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_34)
- {
- goto IL_00de;
- }
- }
- IL_009f:
- {
- intptr_t L_35 = ___L0;
- int32_t L_36 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_35, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_36) == ((uint32_t)3))))
- {
- goto IL_00de;
- }
- }
- IL_00ac:
- {
- ObjectTranslator_t2020767555 * L_37 = V_0;
- intptr_t L_38 = ___L0;
- NullCheck(L_37);
- ObjectTranslator_Get_m1627229423(L_37, L_38, 2, (&V_8), /*hidden argument*/NULL);
- intptr_t L_39 = ___L0;
- double L_40 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- V_9 = (((float)((float)L_40)));
- Transform_t3600365921 * L_41 = V_1;
- Vector3_t3722313464 L_42 = V_8;
- float L_43 = V_9;
- Tweener_t436044680 * L_44 = ShortcutExtensions_DOBlendableLocalRotateBy_m1249688942(NULL /*static, unused*/, L_41, L_42, L_43, 0, /*hidden argument*/NULL);
- V_10 = L_44;
- ObjectTranslator_t2020767555 * L_45 = V_0;
- intptr_t L_46 = ___L0;
- Tweener_t436044680 * L_47 = V_10;
- NullCheck(L_45);
- ObjectTranslator_Push_m105918116(L_45, L_46, L_47, /*hidden argument*/NULL);
- V_7 = 1;
- goto IL_010a;
- }
- IL_00de:
- {
- goto IL_00fe;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_00e3;
- throw e;
- }
- CATCH_00e3:
- { // begin catch(System.Exception)
- V_11 = ((Exception_t *)__exception_local);
- intptr_t L_48 = ___L0;
- Exception_t * L_49 = V_11;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_50 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_49, /*hidden argument*/NULL);
- int32_t L_51 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_48, L_50, /*hidden argument*/NULL);
- V_7 = L_51;
- goto IL_010a;
- } // end catch (depth: 1)
- IL_00fe:
- {
- intptr_t L_52 = ___L0;
- int32_t L_53 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_52, _stringLiteral1875094018, /*hidden argument*/NULL);
- return L_53;
- }
- IL_010a:
- {
- int32_t L_54 = V_7;
- return L_54;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendablePunchRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOBlendablePunchRotation_m4113421389_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- int32_t V_2 = 0;
- Vector3_t3722313464 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- int32_t V_5 = 0;
- float V_6 = 0.0f;
- Tweener_t436044680 * V_7 = NULL;
- int32_t V_8 = 0;
- Vector3_t3722313464 V_9;
- memset(&V_9, 0, sizeof(V_9));
- float V_10 = 0.0f;
- int32_t V_11 = 0;
- Tweener_t436044680 * V_12 = NULL;
- Vector3_t3722313464 V_13;
- memset(&V_13, 0, sizeof(V_13));
- float V_14 = 0.0f;
- Tweener_t436044680 * V_15 = NULL;
- Exception_t * V_16 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_6, /*hidden argument*/NULL);
- V_2 = L_7;
- int32_t L_8 = V_2;
- if ((!(((uint32_t)L_8) == ((uint32_t)5))))
- {
- goto IL_00a3;
- }
- }
- IL_0028:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- bool L_11 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_9, L_10, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_11)
- {
- goto IL_00a3;
- }
- }
- IL_0035:
- {
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_12, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_13) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_0042:
- {
- intptr_t L_14 = ___L0;
- int32_t L_15 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_14, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_15) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_004f:
- {
- intptr_t L_16 = ___L0;
- int32_t L_17 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_16, 5, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_17) == ((uint32_t)3))))
- {
- goto IL_00a3;
- }
- }
- IL_005c:
- {
- ObjectTranslator_t2020767555 * L_18 = V_0;
- intptr_t L_19 = ___L0;
- NullCheck(L_18);
- ObjectTranslator_Get_m1627229423(L_18, L_19, 2, (&V_3), /*hidden argument*/NULL);
- intptr_t L_20 = ___L0;
- double L_21 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_20, 3, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_21)));
- intptr_t L_22 = ___L0;
- int32_t L_23 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_22, 4, /*hidden argument*/NULL);
- V_5 = L_23;
- intptr_t L_24 = ___L0;
- double L_25 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_24, 5, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_25)));
- Transform_t3600365921 * L_26 = V_1;
- Vector3_t3722313464 L_27 = V_3;
- float L_28 = V_4;
- int32_t L_29 = V_5;
- float L_30 = V_6;
- Tweener_t436044680 * L_31 = ShortcutExtensions_DOBlendablePunchRotation_m2677664895(NULL /*static, unused*/, L_26, L_27, L_28, L_29, L_30, /*hidden argument*/NULL);
- V_7 = L_31;
- ObjectTranslator_t2020767555 * L_32 = V_0;
- intptr_t L_33 = ___L0;
- Tweener_t436044680 * L_34 = V_7;
- NullCheck(L_32);
- ObjectTranslator_Push_m105918116(L_32, L_33, L_34, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_00a3:
- {
- int32_t L_35 = V_2;
- if ((!(((uint32_t)L_35) == ((uint32_t)4))))
- {
- goto IL_0112;
- }
- }
- IL_00aa:
- {
- ObjectTranslator_t2020767555 * L_36 = V_0;
- intptr_t L_37 = ___L0;
- NullCheck(L_36);
- bool L_38 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_36, L_37, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_38)
- {
- goto IL_0112;
- }
- }
- IL_00b7:
- {
- intptr_t L_39 = ___L0;
- int32_t L_40 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_39, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_40) == ((uint32_t)3))))
- {
- goto IL_0112;
- }
- }
- IL_00c4:
- {
- intptr_t L_41 = ___L0;
- int32_t L_42 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_41, 4, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_42) == ((uint32_t)3))))
- {
- goto IL_0112;
- }
- }
- IL_00d1:
- {
- ObjectTranslator_t2020767555 * L_43 = V_0;
- intptr_t L_44 = ___L0;
- NullCheck(L_43);
- ObjectTranslator_Get_m1627229423(L_43, L_44, 2, (&V_9), /*hidden argument*/NULL);
- intptr_t L_45 = ___L0;
- double L_46 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_45, 3, /*hidden argument*/NULL);
- V_10 = (((float)((float)L_46)));
- intptr_t L_47 = ___L0;
- int32_t L_48 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_47, 4, /*hidden argument*/NULL);
- V_11 = L_48;
- Transform_t3600365921 * L_49 = V_1;
- Vector3_t3722313464 L_50 = V_9;
- float L_51 = V_10;
- int32_t L_52 = V_11;
- Tweener_t436044680 * L_53 = ShortcutExtensions_DOBlendablePunchRotation_m2677664895(NULL /*static, unused*/, L_49, L_50, L_51, L_52, (1.0f), /*hidden argument*/NULL);
- V_12 = L_53;
- ObjectTranslator_t2020767555 * L_54 = V_0;
- intptr_t L_55 = ___L0;
- Tweener_t436044680 * L_56 = V_12;
- NullCheck(L_54);
- ObjectTranslator_Push_m105918116(L_54, L_55, L_56, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_0112:
- {
- int32_t L_57 = V_2;
- if ((!(((uint32_t)L_57) == ((uint32_t)3))))
- {
- goto IL_016b;
- }
- }
- IL_0119:
- {
- ObjectTranslator_t2020767555 * L_58 = V_0;
- intptr_t L_59 = ___L0;
- NullCheck(L_58);
- bool L_60 = ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163(L_58, L_59, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector3_t3722313464_m2004178163_RuntimeMethod_var);
- if (!L_60)
- {
- goto IL_016b;
- }
- }
- IL_0126:
- {
- intptr_t L_61 = ___L0;
- int32_t L_62 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_61, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_62) == ((uint32_t)3))))
- {
- goto IL_016b;
- }
- }
- IL_0133:
- {
- ObjectTranslator_t2020767555 * L_63 = V_0;
- intptr_t L_64 = ___L0;
- NullCheck(L_63);
- ObjectTranslator_Get_m1627229423(L_63, L_64, 2, (&V_13), /*hidden argument*/NULL);
- intptr_t L_65 = ___L0;
- double L_66 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_65, 3, /*hidden argument*/NULL);
- V_14 = (((float)((float)L_66)));
- Transform_t3600365921 * L_67 = V_1;
- Vector3_t3722313464 L_68 = V_13;
- float L_69 = V_14;
- Tweener_t436044680 * L_70 = ShortcutExtensions_DOBlendablePunchRotation_m2677664895(NULL /*static, unused*/, L_67, L_68, L_69, ((int32_t)10), (1.0f), /*hidden argument*/NULL);
- V_15 = L_70;
- ObjectTranslator_t2020767555 * L_71 = V_0;
- intptr_t L_72 = ___L0;
- Tweener_t436044680 * L_73 = V_15;
- NullCheck(L_71);
- ObjectTranslator_Push_m105918116(L_71, L_72, L_73, /*hidden argument*/NULL);
- V_8 = 1;
- goto IL_0197;
- }
- IL_016b:
- {
- goto IL_018b;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0170;
- throw e;
- }
- CATCH_0170:
- { // begin catch(System.Exception)
- V_16 = ((Exception_t *)__exception_local);
- intptr_t L_74 = ___L0;
- Exception_t * L_75 = V_16;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_76 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_75, /*hidden argument*/NULL);
- int32_t L_77 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_74, L_76, /*hidden argument*/NULL);
- V_8 = L_77;
- goto IL_0197;
- } // end catch (depth: 1)
- IL_018b:
- {
- intptr_t L_78 = ___L0;
- int32_t L_79 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_78, _stringLiteral1467047356, /*hidden argument*/NULL);
- return L_79;
- }
- IL_0197:
- {
- int32_t L_80 = V_8;
- return L_80;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_m_DOBlendableScaleBy(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__m_DOBlendableScaleBy_m3517068162_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- Tweener_t436044680 * V_4 = NULL;
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- double L_9 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_9)));
- Transform_t3600365921 * L_10 = V_1;
- Vector3_t3722313464 L_11 = V_2;
- float L_12 = V_3;
- Tweener_t436044680 * L_13 = ShortcutExtensions_DOBlendableScaleBy_m209393549(NULL /*static, unused*/, L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- Tweener_t436044680 * L_16 = V_4;
- NullCheck(L_14);
- ObjectTranslator_Push_m105918116(L_14, L_15, L_16, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_0063;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0048;
- throw e;
- }
- CATCH_0048:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_5 = L_20;
- goto IL_0063;
- } // end catch (depth: 1)
- IL_0063:
- {
- int32_t L_21 = V_5;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_position(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_position_m2180048924 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_position_m2180048924_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_position_m36019626(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localPosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localPosition_m3878105019 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_localPosition_m3878105019_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_localPosition_m4234289348(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_eulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_eulerAngles_m3922999519 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_eulerAngles_m3922999519_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_eulerAngles_m2743581774(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localEulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_localEulerAngles_m2331560613_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_localEulerAngles_m2136926248(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_right(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_right_m469775628 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_right_m469775628_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_right_m2535262102(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_up(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_up_m3208095539 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_up_m3208095539_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_up_m3972993886(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_forward(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_forward_m2765842083 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_forward_m2765842083_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_forward_m747522392(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_rotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_rotation_m1745653753 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_rotation_m1745653753_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Quaternion_t2301928331 L_9 = Transform_get_rotation_m3502953881(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineQuaternion_m1385659755(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localRotation_m637984894 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_localRotation_m637984894_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Quaternion_t2301928331 L_9 = Transform_get_localRotation_m3487911431(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineQuaternion_m1385659755(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localScale_m3915212871 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_localScale_m3915212871_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_localScale_m129152068(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_parent(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_parent_m3003513812 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_parent_m3003513812_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Transform_t3600365921 * L_9 = Transform_get_parent_m835071599(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_worldToLocalMatrix(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_worldToLocalMatrix_m949067888_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Matrix4x4_t1817901843 L_9 = Transform_get_worldToLocalMatrix_m399704877(L_8, /*hidden argument*/NULL);
- Matrix4x4_t1817901843 L_10 = L_9;
- RuntimeObject * L_11 = Box(Matrix4x4_t1817901843_il2cpp_TypeInfo_var, &L_10);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_11, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0031;
- throw e;
- }
- CATCH_0031:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 1;
- }
- IL_004b:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_localToWorldMatrix(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_localToWorldMatrix_m3652037470_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Matrix4x4_t1817901843 L_9 = Transform_get_localToWorldMatrix_m4155710351(L_8, /*hidden argument*/NULL);
- Matrix4x4_t1817901843 L_10 = L_9;
- RuntimeObject * L_11 = Box(Matrix4x4_t1817901843_il2cpp_TypeInfo_var, &L_10);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_11, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0031;
- throw e;
- }
- CATCH_0031:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 1;
- }
- IL_004b:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_root(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_root_m58896500 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_root_m58896500_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Transform_t3600365921 * L_9 = Transform_get_root_m2450402596(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_Push_m105918116(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_childCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_childCount_m222537369 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_childCount_m222537369_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- Transform_t3600365921 * L_7 = V_1;
- NullCheck(L_7);
- int32_t L_8 = Transform_get_childCount_m3145433196(L_7, /*hidden argument*/NULL);
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_lossyScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_lossyScale_m3129807950 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_lossyScale_m3129807950_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- Transform_t3600365921 * L_8 = V_1;
- NullCheck(L_8);
- Vector3_t3722313464 L_9 = Transform_get_lossyScale_m465496651(L_8, /*hidden argument*/NULL);
- NullCheck(L_6);
- ObjectTranslator_PushUnityEngineVector3_m82247743(L_6, L_7, L_9, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 1;
- }
- IL_0046:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_hasChanged(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_hasChanged_m2133940418 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_hasChanged_m2133940418_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- Transform_t3600365921 * L_7 = V_1;
- NullCheck(L_7);
- bool L_8 = Transform_get_hasChanged_m186929804(L_7, /*hidden argument*/NULL);
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_hierarchyCapacity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_hierarchyCapacity_m1462549588_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- Transform_t3600365921 * L_7 = V_1;
- NullCheck(L_7);
- int32_t L_8 = Transform_get_hierarchyCapacity_m724776931(L_7, /*hidden argument*/NULL);
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_g_get_hierarchyCount(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__g_get_hierarchyCount_m1829242927_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- intptr_t L_6 = ___L0;
- Transform_t3600365921 * L_7 = V_1;
- NullCheck(L_7);
- int32_t L_8 = Transform_get_hierarchyCount_m1774644847(L_7, /*hidden argument*/NULL);
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0043;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002b;
- throw e;
- }
- CATCH_002b:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0043:
- {
- return 1;
- }
- IL_0045:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_position(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_position_m2248180735 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_position_m2248180735_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_position_m3387557959(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localPosition(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localPosition_m572438127 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_localPosition_m572438127_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_localPosition_m4128471975(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_eulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_eulerAngles_m2405101980 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_eulerAngles_m2405101980_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_eulerAngles_m135219616(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localEulerAngles(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_localEulerAngles_m1984433639_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_localEulerAngles_m4202601546(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_right(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_right_m1502050898 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_right_m1502050898_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_right_m1787339266(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_up(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_up_m1616193993 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_up_m1616193993_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_up_m3321958190(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_forward(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_forward_m1425629139 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_forward_m1425629139_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_forward_m1840797198(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_rotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_rotation_m2344385924 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_rotation_m2344385924_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Quaternion_t2301928331 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m3946340519(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Quaternion_t2301928331 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_rotation_m3524318132(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localRotation(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localRotation_m3029152408 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_localRotation_m3029152408_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Quaternion_t2301928331 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m3946340519(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Quaternion_t2301928331 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_localRotation_m19445462(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_localScale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_localScale_m1212933853 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_localScale_m1212933853_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Vector3_t3722313464 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Exception_t * V_3 = NULL;
- int32_t V_4 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- ObjectTranslator_Get_m1627229423(L_6, L_7, 2, (&V_2), /*hidden argument*/NULL);
- Transform_t3600365921 * L_8 = V_1;
- Vector3_t3722313464 L_9 = V_2;
- NullCheck(L_8);
- Transform_set_localScale_m3053443106(L_8, L_9, /*hidden argument*/NULL);
- goto IL_0049;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0030;
- throw e;
- }
- CATCH_0030:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_4 = L_13;
- goto IL_004b;
- } // end catch (depth: 1)
- IL_0049:
- {
- return 0;
- }
- IL_004b:
- {
- int32_t L_14 = V_4;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_parent(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_parent_m3451686420 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_parent_m3451686420_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- RuntimeTypeHandle_t3027515415 L_9 = { reinterpret_cast<intptr_t> (Transform_t3600365921_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_10 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_9, /*hidden argument*/NULL);
- NullCheck(L_7);
- RuntimeObject * L_11 = ObjectTranslator_GetObject_m805173647(L_7, L_8, 2, L_10, /*hidden argument*/NULL);
- NullCheck(L_6);
- Transform_set_parent_m786917804(L_6, ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_11, Transform_t3600365921_il2cpp_TypeInfo_var)), /*hidden argument*/NULL);
- goto IL_0054;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003c;
- throw e;
- }
- CATCH_003c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_3 = L_15;
- goto IL_0056;
- } // end catch (depth: 1)
- IL_0054:
- {
- return 0;
- }
- IL_0056:
- {
- int32_t L_16 = V_3;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_hasChanged(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_hasChanged_m195551608 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_hasChanged_m195551608_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- intptr_t L_7 = ___L0;
- bool L_8 = Lua_lua_toboolean_m3020476153(NULL /*static, unused*/, L_7, 2, /*hidden argument*/NULL);
- NullCheck(L_6);
- Transform_set_hasChanged_m4213723989(L_6, L_8, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 0;
- }
- IL_0046:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineTransformWrap::_s_set_hierarchyCapacity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineTransformWrap__s_set_hierarchyCapacity_m1846269174_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Transform_t3600365921 * V_1 = NULL;
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- RuntimeObject * L_5 = ObjectTranslator_FastGetCSObj_m66620763(L_3, L_4, 1, /*hidden argument*/NULL);
- V_1 = ((Transform_t3600365921 *)CastclassClass((RuntimeObject*)L_5, Transform_t3600365921_il2cpp_TypeInfo_var));
- Transform_t3600365921 * L_6 = V_1;
- intptr_t L_7 = ___L0;
- int32_t L_8 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_7, 2, /*hidden argument*/NULL);
- NullCheck(L_6);
- Transform_set_hierarchyCapacity_m813979291(L_6, L_8, /*hidden argument*/NULL);
- goto IL_0044;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0044:
- {
- return 0;
- }
- IL_0046:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
- #ifdef __clang__
- #pragma clang diagnostic push
- #pragma clang diagnostic ignored "-Winvalid-offsetof"
- #pragma clang diagnostic ignored "-Wunused-variable"
- #endif
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___CreateInstance_m3609981491(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___CreateInstance_m3609981491(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___CSIndexer_m1160094481(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___CSIndexer_m1160094481(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___NewIndexer_m2412137810(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___NewIndexer_m2412137810(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___AddMeta_m377273840(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___AddMeta_m377273840(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___SubMeta_m2441875035(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___SubMeta_m2441875035(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___UnmMeta_m4167622536(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___UnmMeta_m4167622536(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___MulMeta_m3110680190(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___MulMeta_m3110680190(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___DivMeta_m697562865(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___DivMeta_m697562865(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap___EqMeta_m3842372935(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap___EqMeta_m3842372935(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Set_m4206157458(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Set_m4206157458(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Scale_m3402797960(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Scale_m3402797960(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Normalize_m2064805032(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Normalize_m2064805032(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_ToString_m3633924156(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_ToString_m3633924156(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_GetHashCode_m3805233334(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_GetHashCode_m3805233334(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Equals_m4260714512(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Equals_m4260714512(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_normalized_m1526536551(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_normalized_m1526536551(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_magnitude_m1920742942(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_magnitude_m1920742942(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_zero_m4234870038(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_zero_m4234870038(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_one_m1876688525(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_one_m1876688525(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_up_m2923378165(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_up_m2923378165(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_down_m2946352740(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_down_m2946352740(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_left_m158211399(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_left_m158211399(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_right_m77832184(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_right_m77832184(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_x_m4147433016(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_x_m4147433016(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__g_get_y_m2714693255(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__g_get_y_m2714693255(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__s_set_x_m2341483890(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__s_set_x_m2341483890(NULL, ___L0, NULL);
- return returnValue;
- }
- extern "C" int32_t DEFAULT_CALL ReversePInvokeWrapper_UnityEngineVector2Wrap__s_set_y_m3798992961(intptr_t ___L0)
- {
- il2cpp_native_wrapper_vm_thread_attacher _vmThreadHelper;
- // Managed method invocation
- int32_t returnValue = UnityEngineVector2Wrap__s_set_y_m3798992961(NULL, ___L0, NULL);
- return returnValue;
- }
- // System.Void XLua.CSObjectWrap.UnityEngineVector2Wrap::.ctor()
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineVector2Wrap__ctor_m1454520438 (UnityEngineVector2Wrap_t2602506976 * __this, const RuntimeMethod* method)
- {
- {
- Object__ctor_m297566312(__this, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Void XLua.CSObjectWrap.UnityEngineVector2Wrap::__Register(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR void UnityEngineVector2Wrap___Register_m818258078 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___Register_m818258078_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Type_t * V_1 = NULL;
- String_t* G_B2_0 = NULL;
- int32_t G_B2_1 = 0;
- intptr_t G_B2_2;
- memset(&G_B2_2, 0, sizeof(G_B2_2));
- String_t* G_B1_0 = NULL;
- int32_t G_B1_1 = 0;
- intptr_t G_B1_2;
- memset(&G_B1_2, 0, sizeof(G_B1_2));
- String_t* G_B4_0 = NULL;
- int32_t G_B4_1 = 0;
- intptr_t G_B4_2;
- memset(&G_B4_2, 0, sizeof(G_B4_2));
- String_t* G_B3_0 = NULL;
- int32_t G_B3_1 = 0;
- intptr_t G_B3_2;
- memset(&G_B3_2, 0, sizeof(G_B3_2));
- String_t* G_B6_0 = NULL;
- int32_t G_B6_1 = 0;
- intptr_t G_B6_2;
- memset(&G_B6_2, 0, sizeof(G_B6_2));
- String_t* G_B5_0 = NULL;
- int32_t G_B5_1 = 0;
- intptr_t G_B5_2;
- memset(&G_B5_2, 0, sizeof(G_B5_2));
- String_t* G_B8_0 = NULL;
- int32_t G_B8_1 = 0;
- intptr_t G_B8_2;
- memset(&G_B8_2, 0, sizeof(G_B8_2));
- String_t* G_B7_0 = NULL;
- int32_t G_B7_1 = 0;
- intptr_t G_B7_2;
- memset(&G_B7_2, 0, sizeof(G_B7_2));
- String_t* G_B10_0 = NULL;
- int32_t G_B10_1 = 0;
- intptr_t G_B10_2;
- memset(&G_B10_2, 0, sizeof(G_B10_2));
- String_t* G_B9_0 = NULL;
- int32_t G_B9_1 = 0;
- intptr_t G_B9_2;
- memset(&G_B9_2, 0, sizeof(G_B9_2));
- String_t* G_B12_0 = NULL;
- int32_t G_B12_1 = 0;
- intptr_t G_B12_2;
- memset(&G_B12_2, 0, sizeof(G_B12_2));
- String_t* G_B11_0 = NULL;
- int32_t G_B11_1 = 0;
- intptr_t G_B11_2;
- memset(&G_B11_2, 0, sizeof(G_B11_2));
- String_t* G_B14_0 = NULL;
- int32_t G_B14_1 = 0;
- intptr_t G_B14_2;
- memset(&G_B14_2, 0, sizeof(G_B14_2));
- String_t* G_B13_0 = NULL;
- int32_t G_B13_1 = 0;
- intptr_t G_B13_2;
- memset(&G_B13_2, 0, sizeof(G_B13_2));
- String_t* G_B16_0 = NULL;
- int32_t G_B16_1 = 0;
- intptr_t G_B16_2;
- memset(&G_B16_2, 0, sizeof(G_B16_2));
- String_t* G_B15_0 = NULL;
- int32_t G_B15_1 = 0;
- intptr_t G_B15_2;
- memset(&G_B15_2, 0, sizeof(G_B15_2));
- String_t* G_B18_0 = NULL;
- int32_t G_B18_1 = 0;
- intptr_t G_B18_2;
- memset(&G_B18_2, 0, sizeof(G_B18_2));
- String_t* G_B17_0 = NULL;
- int32_t G_B17_1 = 0;
- intptr_t G_B17_2;
- memset(&G_B17_2, 0, sizeof(G_B17_2));
- String_t* G_B20_0 = NULL;
- int32_t G_B20_1 = 0;
- intptr_t G_B20_2;
- memset(&G_B20_2, 0, sizeof(G_B20_2));
- String_t* G_B19_0 = NULL;
- int32_t G_B19_1 = 0;
- intptr_t G_B19_2;
- memset(&G_B19_2, 0, sizeof(G_B19_2));
- String_t* G_B22_0 = NULL;
- int32_t G_B22_1 = 0;
- intptr_t G_B22_2;
- memset(&G_B22_2, 0, sizeof(G_B22_2));
- String_t* G_B21_0 = NULL;
- int32_t G_B21_1 = 0;
- intptr_t G_B21_2;
- memset(&G_B21_2, 0, sizeof(G_B21_2));
- String_t* G_B24_0 = NULL;
- int32_t G_B24_1 = 0;
- intptr_t G_B24_2;
- memset(&G_B24_2, 0, sizeof(G_B24_2));
- String_t* G_B23_0 = NULL;
- int32_t G_B23_1 = 0;
- intptr_t G_B23_2;
- memset(&G_B23_2, 0, sizeof(G_B23_2));
- String_t* G_B26_0 = NULL;
- int32_t G_B26_1 = 0;
- intptr_t G_B26_2;
- memset(&G_B26_2, 0, sizeof(G_B26_2));
- String_t* G_B25_0 = NULL;
- int32_t G_B25_1 = 0;
- intptr_t G_B25_2;
- memset(&G_B25_2, 0, sizeof(G_B25_2));
- String_t* G_B28_0 = NULL;
- int32_t G_B28_1 = 0;
- intptr_t G_B28_2;
- memset(&G_B28_2, 0, sizeof(G_B28_2));
- String_t* G_B27_0 = NULL;
- int32_t G_B27_1 = 0;
- intptr_t G_B27_2;
- memset(&G_B27_2, 0, sizeof(G_B27_2));
- String_t* G_B30_0 = NULL;
- int32_t G_B30_1 = 0;
- intptr_t G_B30_2;
- memset(&G_B30_2, 0, sizeof(G_B30_2));
- String_t* G_B29_0 = NULL;
- int32_t G_B29_1 = 0;
- intptr_t G_B29_2;
- memset(&G_B29_2, 0, sizeof(G_B29_2));
- String_t* G_B32_0 = NULL;
- int32_t G_B32_1 = 0;
- intptr_t G_B32_2;
- memset(&G_B32_2, 0, sizeof(G_B32_2));
- String_t* G_B31_0 = NULL;
- int32_t G_B31_1 = 0;
- intptr_t G_B31_2;
- memset(&G_B31_2, 0, sizeof(G_B31_2));
- String_t* G_B34_0 = NULL;
- int32_t G_B34_1 = 0;
- intptr_t G_B34_2;
- memset(&G_B34_2, 0, sizeof(G_B34_2));
- String_t* G_B33_0 = NULL;
- int32_t G_B33_1 = 0;
- intptr_t G_B33_2;
- memset(&G_B33_2, 0, sizeof(G_B33_2));
- String_t* G_B36_0 = NULL;
- int32_t G_B36_1 = 0;
- intptr_t G_B36_2;
- memset(&G_B36_2, 0, sizeof(G_B36_2));
- String_t* G_B35_0 = NULL;
- int32_t G_B35_1 = 0;
- intptr_t G_B35_2;
- memset(&G_B35_2, 0, sizeof(G_B35_2));
- String_t* G_B38_0 = NULL;
- int32_t G_B38_1 = 0;
- intptr_t G_B38_2;
- memset(&G_B38_2, 0, sizeof(G_B38_2));
- String_t* G_B37_0 = NULL;
- int32_t G_B37_1 = 0;
- intptr_t G_B37_2;
- memset(&G_B37_2, 0, sizeof(G_B37_2));
- String_t* G_B40_0 = NULL;
- int32_t G_B40_1 = 0;
- intptr_t G_B40_2;
- memset(&G_B40_2, 0, sizeof(G_B40_2));
- String_t* G_B39_0 = NULL;
- int32_t G_B39_1 = 0;
- intptr_t G_B39_2;
- memset(&G_B39_2, 0, sizeof(G_B39_2));
- ObjectTranslator_t2020767555 * G_B42_0 = NULL;
- intptr_t G_B42_1;
- memset(&G_B42_1, 0, sizeof(G_B42_1));
- Type_t * G_B42_2 = NULL;
- ObjectTranslator_t2020767555 * G_B41_0 = NULL;
- intptr_t G_B41_1;
- memset(&G_B41_1, 0, sizeof(G_B41_1));
- Type_t * G_B41_2 = NULL;
- lua_CSFunction_t883524059 * G_B44_0 = NULL;
- ObjectTranslator_t2020767555 * G_B44_1 = NULL;
- intptr_t G_B44_2;
- memset(&G_B44_2, 0, sizeof(G_B44_2));
- Type_t * G_B44_3 = NULL;
- lua_CSFunction_t883524059 * G_B43_0 = NULL;
- ObjectTranslator_t2020767555 * G_B43_1 = NULL;
- intptr_t G_B43_2;
- memset(&G_B43_2, 0, sizeof(G_B43_2));
- Type_t * G_B43_3 = NULL;
- intptr_t G_B46_0;
- memset(&G_B46_0, 0, sizeof(G_B46_0));
- Type_t * G_B46_1 = NULL;
- intptr_t G_B45_0;
- memset(&G_B45_0, 0, sizeof(G_B45_0));
- Type_t * G_B45_1 = NULL;
- String_t* G_B48_0 = NULL;
- int32_t G_B48_1 = 0;
- intptr_t G_B48_2;
- memset(&G_B48_2, 0, sizeof(G_B48_2));
- String_t* G_B47_0 = NULL;
- int32_t G_B47_1 = 0;
- intptr_t G_B47_2;
- memset(&G_B47_2, 0, sizeof(G_B47_2));
- String_t* G_B50_0 = NULL;
- int32_t G_B50_1 = 0;
- intptr_t G_B50_2;
- memset(&G_B50_2, 0, sizeof(G_B50_2));
- String_t* G_B49_0 = NULL;
- int32_t G_B49_1 = 0;
- intptr_t G_B49_2;
- memset(&G_B49_2, 0, sizeof(G_B49_2));
- String_t* G_B52_0 = NULL;
- int32_t G_B52_1 = 0;
- intptr_t G_B52_2;
- memset(&G_B52_2, 0, sizeof(G_B52_2));
- String_t* G_B51_0 = NULL;
- int32_t G_B51_1 = 0;
- intptr_t G_B51_2;
- memset(&G_B51_2, 0, sizeof(G_B51_2));
- String_t* G_B54_0 = NULL;
- int32_t G_B54_1 = 0;
- intptr_t G_B54_2;
- memset(&G_B54_2, 0, sizeof(G_B54_2));
- String_t* G_B53_0 = NULL;
- int32_t G_B53_1 = 0;
- intptr_t G_B53_2;
- memset(&G_B53_2, 0, sizeof(G_B53_2));
- String_t* G_B56_0 = NULL;
- int32_t G_B56_1 = 0;
- intptr_t G_B56_2;
- memset(&G_B56_2, 0, sizeof(G_B56_2));
- String_t* G_B55_0 = NULL;
- int32_t G_B55_1 = 0;
- intptr_t G_B55_2;
- memset(&G_B55_2, 0, sizeof(G_B55_2));
- String_t* G_B58_0 = NULL;
- int32_t G_B58_1 = 0;
- intptr_t G_B58_2;
- memset(&G_B58_2, 0, sizeof(G_B58_2));
- String_t* G_B57_0 = NULL;
- int32_t G_B57_1 = 0;
- intptr_t G_B57_2;
- memset(&G_B57_2, 0, sizeof(G_B57_2));
- String_t* G_B60_0 = NULL;
- int32_t G_B60_1 = 0;
- intptr_t G_B60_2;
- memset(&G_B60_2, 0, sizeof(G_B60_2));
- String_t* G_B59_0 = NULL;
- int32_t G_B59_1 = 0;
- intptr_t G_B59_2;
- memset(&G_B59_2, 0, sizeof(G_B59_2));
- String_t* G_B62_0 = NULL;
- int32_t G_B62_1 = 0;
- intptr_t G_B62_2;
- memset(&G_B62_2, 0, sizeof(G_B62_2));
- String_t* G_B61_0 = NULL;
- int32_t G_B61_1 = 0;
- intptr_t G_B61_2;
- memset(&G_B61_2, 0, sizeof(G_B61_2));
- String_t* G_B64_0 = NULL;
- int32_t G_B64_1 = 0;
- intptr_t G_B64_2;
- memset(&G_B64_2, 0, sizeof(G_B64_2));
- String_t* G_B63_0 = NULL;
- int32_t G_B63_1 = 0;
- intptr_t G_B63_2;
- memset(&G_B63_2, 0, sizeof(G_B63_2));
- String_t* G_B66_0 = NULL;
- int32_t G_B66_1 = 0;
- intptr_t G_B66_2;
- memset(&G_B66_2, 0, sizeof(G_B66_2));
- String_t* G_B65_0 = NULL;
- int32_t G_B65_1 = 0;
- intptr_t G_B65_2;
- memset(&G_B65_2, 0, sizeof(G_B65_2));
- String_t* G_B68_0 = NULL;
- int32_t G_B68_1 = 0;
- intptr_t G_B68_2;
- memset(&G_B68_2, 0, sizeof(G_B68_2));
- String_t* G_B67_0 = NULL;
- int32_t G_B67_1 = 0;
- intptr_t G_B67_2;
- memset(&G_B67_2, 0, sizeof(G_B67_2));
- String_t* G_B70_0 = NULL;
- int32_t G_B70_1 = 0;
- intptr_t G_B70_2;
- memset(&G_B70_2, 0, sizeof(G_B70_2));
- String_t* G_B69_0 = NULL;
- int32_t G_B69_1 = 0;
- intptr_t G_B69_2;
- memset(&G_B69_2, 0, sizeof(G_B69_2));
- String_t* G_B72_0 = NULL;
- int32_t G_B72_1 = 0;
- intptr_t G_B72_2;
- memset(&G_B72_2, 0, sizeof(G_B72_2));
- String_t* G_B71_0 = NULL;
- int32_t G_B71_1 = 0;
- intptr_t G_B71_2;
- memset(&G_B71_2, 0, sizeof(G_B71_2));
- String_t* G_B74_0 = NULL;
- int32_t G_B74_1 = 0;
- intptr_t G_B74_2;
- memset(&G_B74_2, 0, sizeof(G_B74_2));
- String_t* G_B73_0 = NULL;
- int32_t G_B73_1 = 0;
- intptr_t G_B73_2;
- memset(&G_B73_2, 0, sizeof(G_B73_2));
- String_t* G_B76_0 = NULL;
- int32_t G_B76_1 = 0;
- intptr_t G_B76_2;
- memset(&G_B76_2, 0, sizeof(G_B76_2));
- String_t* G_B75_0 = NULL;
- int32_t G_B75_1 = 0;
- intptr_t G_B75_2;
- memset(&G_B75_2, 0, sizeof(G_B75_2));
- String_t* G_B78_0 = NULL;
- int32_t G_B78_1 = 0;
- intptr_t G_B78_2;
- memset(&G_B78_2, 0, sizeof(G_B78_2));
- String_t* G_B77_0 = NULL;
- int32_t G_B77_1 = 0;
- intptr_t G_B77_2;
- memset(&G_B77_2, 0, sizeof(G_B77_2));
- String_t* G_B80_0 = NULL;
- int32_t G_B80_1 = 0;
- intptr_t G_B80_2;
- memset(&G_B80_2, 0, sizeof(G_B80_2));
- String_t* G_B79_0 = NULL;
- int32_t G_B79_1 = 0;
- intptr_t G_B79_2;
- memset(&G_B79_2, 0, sizeof(G_B79_2));
- String_t* G_B82_0 = NULL;
- int32_t G_B82_1 = 0;
- intptr_t G_B82_2;
- memset(&G_B82_2, 0, sizeof(G_B82_2));
- String_t* G_B81_0 = NULL;
- int32_t G_B81_1 = 0;
- intptr_t G_B81_2;
- memset(&G_B81_2, 0, sizeof(G_B81_2));
- String_t* G_B84_0 = NULL;
- int32_t G_B84_1 = 0;
- intptr_t G_B84_2;
- memset(&G_B84_2, 0, sizeof(G_B84_2));
- String_t* G_B83_0 = NULL;
- int32_t G_B83_1 = 0;
- intptr_t G_B83_2;
- memset(&G_B83_2, 0, sizeof(G_B83_2));
- String_t* G_B86_0 = NULL;
- int32_t G_B86_1 = 0;
- intptr_t G_B86_2;
- memset(&G_B86_2, 0, sizeof(G_B86_2));
- String_t* G_B85_0 = NULL;
- int32_t G_B85_1 = 0;
- intptr_t G_B85_2;
- memset(&G_B85_2, 0, sizeof(G_B85_2));
- String_t* G_B88_0 = NULL;
- int32_t G_B88_1 = 0;
- intptr_t G_B88_2;
- memset(&G_B88_2, 0, sizeof(G_B88_2));
- String_t* G_B87_0 = NULL;
- int32_t G_B87_1 = 0;
- intptr_t G_B87_2;
- memset(&G_B87_2, 0, sizeof(G_B87_2));
- String_t* G_B90_0 = NULL;
- int32_t G_B90_1 = 0;
- intptr_t G_B90_2;
- memset(&G_B90_2, 0, sizeof(G_B90_2));
- String_t* G_B89_0 = NULL;
- int32_t G_B89_1 = 0;
- intptr_t G_B89_2;
- memset(&G_B89_2, 0, sizeof(G_B89_2));
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- RuntimeTypeHandle_t3027515415 L_3 = { reinterpret_cast<intptr_t> (Vector2_t2156229523_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_4 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- V_1 = L_4;
- Type_t * L_5 = V_1;
- intptr_t L_6 = ___L0;
- ObjectTranslator_t2020767555 * L_7 = V_0;
- Utils_BeginObjectRegister_m972381667(NULL /*static, unused*/, L_5, L_6, L_7, 6, 7, 5, 2, (-1), /*hidden argument*/NULL);
- intptr_t L_8 = ___L0;
- lua_CSFunction_t883524059 * L_9 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- G_B1_0 = _stringLiteral3641224616;
- G_B1_1 = ((int32_t)-4);
- G_B1_2 = L_8;
- if (L_9)
- {
- G_B2_0 = _stringLiteral3641224616;
- G_B2_1 = ((int32_t)-4);
- G_B2_2 = L_8;
- goto IL_0044;
- }
- }
- {
- intptr_t L_10 = (intptr_t)UnityEngineVector2Wrap___AddMeta_m377273840_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_11 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_11, NULL, L_10, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache0_0(L_11);
- G_B2_0 = G_B1_0;
- G_B2_1 = G_B1_1;
- G_B2_2 = G_B1_2;
- }
- IL_0044:
- {
- lua_CSFunction_t883524059 * L_12 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache0_0();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B2_2, G_B2_1, G_B2_0, L_12, /*hidden argument*/NULL);
- intptr_t L_13 = ___L0;
- lua_CSFunction_t883524059 * L_14 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- G_B3_0 = _stringLiteral516640048;
- G_B3_1 = ((int32_t)-4);
- G_B3_2 = L_13;
- if (L_14)
- {
- G_B4_0 = _stringLiteral516640048;
- G_B4_1 = ((int32_t)-4);
- G_B4_2 = L_13;
- goto IL_006e;
- }
- }
- {
- intptr_t L_15 = (intptr_t)UnityEngineVector2Wrap___SubMeta_m2441875035_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_16 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_16, NULL, L_15, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1_1(L_16);
- G_B4_0 = G_B3_0;
- G_B4_1 = G_B3_1;
- G_B4_2 = G_B3_2;
- }
- IL_006e:
- {
- lua_CSFunction_t883524059 * L_17 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1_1();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B4_2, G_B4_1, G_B4_0, L_17, /*hidden argument*/NULL);
- intptr_t L_18 = ___L0;
- lua_CSFunction_t883524059 * L_19 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- G_B5_0 = _stringLiteral2106406493;
- G_B5_1 = ((int32_t)-4);
- G_B5_2 = L_18;
- if (L_19)
- {
- G_B6_0 = _stringLiteral2106406493;
- G_B6_1 = ((int32_t)-4);
- G_B6_2 = L_18;
- goto IL_0098;
- }
- }
- {
- intptr_t L_20 = (intptr_t)UnityEngineVector2Wrap___UnmMeta_m4167622536_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_21 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_21, NULL, L_20, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2_2(L_21);
- G_B6_0 = G_B5_0;
- G_B6_1 = G_B5_1;
- G_B6_2 = G_B5_2;
- }
- IL_0098:
- {
- lua_CSFunction_t883524059 * L_22 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2_2();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B6_2, G_B6_1, G_B6_0, L_22, /*hidden argument*/NULL);
- intptr_t L_23 = ___L0;
- lua_CSFunction_t883524059 * L_24 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- G_B7_0 = _stringLiteral2035669812;
- G_B7_1 = ((int32_t)-4);
- G_B7_2 = L_23;
- if (L_24)
- {
- G_B8_0 = _stringLiteral2035669812;
- G_B8_1 = ((int32_t)-4);
- G_B8_2 = L_23;
- goto IL_00c2;
- }
- }
- {
- intptr_t L_25 = (intptr_t)UnityEngineVector2Wrap___MulMeta_m3110680190_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_26 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_26, NULL, L_25, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache3_3(L_26);
- G_B8_0 = G_B7_0;
- G_B8_1 = G_B7_1;
- G_B8_2 = G_B7_2;
- }
- IL_00c2:
- {
- lua_CSFunction_t883524059 * L_27 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache3_3();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B8_2, G_B8_1, G_B8_0, L_27, /*hidden argument*/NULL);
- intptr_t L_28 = ___L0;
- lua_CSFunction_t883524059 * L_29 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- G_B9_0 = _stringLiteral3193310087;
- G_B9_1 = ((int32_t)-4);
- G_B9_2 = L_28;
- if (L_29)
- {
- G_B10_0 = _stringLiteral3193310087;
- G_B10_1 = ((int32_t)-4);
- G_B10_2 = L_28;
- goto IL_00ec;
- }
- }
- {
- intptr_t L_30 = (intptr_t)UnityEngineVector2Wrap___DivMeta_m697562865_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_31 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_31, NULL, L_30, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache4_4(L_31);
- G_B10_0 = G_B9_0;
- G_B10_1 = G_B9_1;
- G_B10_2 = G_B9_2;
- }
- IL_00ec:
- {
- lua_CSFunction_t883524059 * L_32 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache4_4();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B10_2, G_B10_1, G_B10_0, L_32, /*hidden argument*/NULL);
- intptr_t L_33 = ___L0;
- lua_CSFunction_t883524059 * L_34 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- G_B11_0 = _stringLiteral4245602690;
- G_B11_1 = ((int32_t)-4);
- G_B11_2 = L_33;
- if (L_34)
- {
- G_B12_0 = _stringLiteral4245602690;
- G_B12_1 = ((int32_t)-4);
- G_B12_2 = L_33;
- goto IL_0116;
- }
- }
- {
- intptr_t L_35 = (intptr_t)UnityEngineVector2Wrap___EqMeta_m3842372935_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_36 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_36, NULL, L_35, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache5_5(L_36);
- G_B12_0 = G_B11_0;
- G_B12_1 = G_B11_1;
- G_B12_2 = G_B11_2;
- }
- IL_0116:
- {
- lua_CSFunction_t883524059 * L_37 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache5_5();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B12_2, G_B12_1, G_B12_0, L_37, /*hidden argument*/NULL);
- intptr_t L_38 = ___L0;
- lua_CSFunction_t883524059 * L_39 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- G_B13_0 = _stringLiteral2553217843;
- G_B13_1 = ((int32_t)-3);
- G_B13_2 = L_38;
- if (L_39)
- {
- G_B14_0 = _stringLiteral2553217843;
- G_B14_1 = ((int32_t)-3);
- G_B14_2 = L_38;
- goto IL_0140;
- }
- }
- {
- intptr_t L_40 = (intptr_t)UnityEngineVector2Wrap__m_Set_m4206157458_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_41 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_41, NULL, L_40, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache6_6(L_41);
- G_B14_0 = G_B13_0;
- G_B14_1 = G_B13_1;
- G_B14_2 = G_B13_2;
- }
- IL_0140:
- {
- lua_CSFunction_t883524059 * L_42 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache6_6();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B14_2, G_B14_1, G_B14_0, L_42, /*hidden argument*/NULL);
- intptr_t L_43 = ___L0;
- lua_CSFunction_t883524059 * L_44 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- G_B15_0 = _stringLiteral763145517;
- G_B15_1 = ((int32_t)-3);
- G_B15_2 = L_43;
- if (L_44)
- {
- G_B16_0 = _stringLiteral763145517;
- G_B16_1 = ((int32_t)-3);
- G_B16_2 = L_43;
- goto IL_016a;
- }
- }
- {
- intptr_t L_45 = (intptr_t)UnityEngineVector2Wrap__m_Scale_m3402797960_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_46 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_46, NULL, L_45, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache7_7(L_46);
- G_B16_0 = G_B15_0;
- G_B16_1 = G_B15_1;
- G_B16_2 = G_B15_2;
- }
- IL_016a:
- {
- lua_CSFunction_t883524059 * L_47 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache7_7();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B16_2, G_B16_1, G_B16_0, L_47, /*hidden argument*/NULL);
- intptr_t L_48 = ___L0;
- lua_CSFunction_t883524059 * L_49 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- G_B17_0 = _stringLiteral347475160;
- G_B17_1 = ((int32_t)-3);
- G_B17_2 = L_48;
- if (L_49)
- {
- G_B18_0 = _stringLiteral347475160;
- G_B18_1 = ((int32_t)-3);
- G_B18_2 = L_48;
- goto IL_0194;
- }
- }
- {
- intptr_t L_50 = (intptr_t)UnityEngineVector2Wrap__m_Normalize_m2064805032_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_51 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_51, NULL, L_50, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache8_8(L_51);
- G_B18_0 = G_B17_0;
- G_B18_1 = G_B17_1;
- G_B18_2 = G_B17_2;
- }
- IL_0194:
- {
- lua_CSFunction_t883524059 * L_52 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache8_8();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B18_2, G_B18_1, G_B18_0, L_52, /*hidden argument*/NULL);
- intptr_t L_53 = ___L0;
- lua_CSFunction_t883524059 * L_54 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- G_B19_0 = _stringLiteral3020121551;
- G_B19_1 = ((int32_t)-3);
- G_B19_2 = L_53;
- if (L_54)
- {
- G_B20_0 = _stringLiteral3020121551;
- G_B20_1 = ((int32_t)-3);
- G_B20_2 = L_53;
- goto IL_01be;
- }
- }
- {
- intptr_t L_55 = (intptr_t)UnityEngineVector2Wrap__m_ToString_m3633924156_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_56 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_56, NULL, L_55, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache9_9(L_56);
- G_B20_0 = G_B19_0;
- G_B20_1 = G_B19_1;
- G_B20_2 = G_B19_2;
- }
- IL_01be:
- {
- lua_CSFunction_t883524059 * L_57 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache9_9();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B20_2, G_B20_1, G_B20_0, L_57, /*hidden argument*/NULL);
- intptr_t L_58 = ___L0;
- lua_CSFunction_t883524059 * L_59 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- G_B21_0 = _stringLiteral476607165;
- G_B21_1 = ((int32_t)-3);
- G_B21_2 = L_58;
- if (L_59)
- {
- G_B22_0 = _stringLiteral476607165;
- G_B22_1 = ((int32_t)-3);
- G_B22_2 = L_58;
- goto IL_01e8;
- }
- }
- {
- intptr_t L_60 = (intptr_t)UnityEngineVector2Wrap__m_GetHashCode_m3805233334_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_61 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_61, NULL, L_60, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheA_10(L_61);
- G_B22_0 = G_B21_0;
- G_B22_1 = G_B21_1;
- G_B22_2 = G_B21_2;
- }
- IL_01e8:
- {
- lua_CSFunction_t883524059 * L_62 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheA_10();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B22_2, G_B22_1, G_B22_0, L_62, /*hidden argument*/NULL);
- intptr_t L_63 = ___L0;
- lua_CSFunction_t883524059 * L_64 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- G_B23_0 = _stringLiteral3610063950;
- G_B23_1 = ((int32_t)-3);
- G_B23_2 = L_63;
- if (L_64)
- {
- G_B24_0 = _stringLiteral3610063950;
- G_B24_1 = ((int32_t)-3);
- G_B24_2 = L_63;
- goto IL_0212;
- }
- }
- {
- intptr_t L_65 = (intptr_t)UnityEngineVector2Wrap__m_Equals_m4260714512_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_66 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_66, NULL, L_65, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheB_11(L_66);
- G_B24_0 = G_B23_0;
- G_B24_1 = G_B23_1;
- G_B24_2 = G_B23_2;
- }
- IL_0212:
- {
- lua_CSFunction_t883524059 * L_67 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheB_11();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B24_2, G_B24_1, G_B24_0, L_67, /*hidden argument*/NULL);
- intptr_t L_68 = ___L0;
- lua_CSFunction_t883524059 * L_69 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- G_B25_0 = _stringLiteral377894624;
- G_B25_1 = ((int32_t)-3);
- G_B25_2 = L_68;
- if (L_69)
- {
- G_B26_0 = _stringLiteral377894624;
- G_B26_1 = ((int32_t)-3);
- G_B26_2 = L_68;
- goto IL_023c;
- }
- }
- {
- intptr_t L_70 = (intptr_t)UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_71 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_71, NULL, L_70, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheC_12(L_71);
- G_B26_0 = G_B25_0;
- G_B26_1 = G_B25_1;
- G_B26_2 = G_B25_2;
- }
- IL_023c:
- {
- lua_CSFunction_t883524059 * L_72 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheC_12();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B26_2, G_B26_1, G_B26_0, L_72, /*hidden argument*/NULL);
- intptr_t L_73 = ___L0;
- lua_CSFunction_t883524059 * L_74 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- G_B27_0 = _stringLiteral349801912;
- G_B27_1 = ((int32_t)-2);
- G_B27_2 = L_73;
- if (L_74)
- {
- G_B28_0 = _stringLiteral349801912;
- G_B28_1 = ((int32_t)-2);
- G_B28_2 = L_73;
- goto IL_0266;
- }
- }
- {
- intptr_t L_75 = (intptr_t)UnityEngineVector2Wrap__g_get_normalized_m1526536551_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_76 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_76, NULL, L_75, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheD_13(L_76);
- G_B28_0 = G_B27_0;
- G_B28_1 = G_B27_1;
- G_B28_2 = G_B27_2;
- }
- IL_0266:
- {
- lua_CSFunction_t883524059 * L_77 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheD_13();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B28_2, G_B28_1, G_B28_0, L_77, /*hidden argument*/NULL);
- intptr_t L_78 = ___L0;
- lua_CSFunction_t883524059 * L_79 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- G_B29_0 = _stringLiteral1482132450;
- G_B29_1 = ((int32_t)-2);
- G_B29_2 = L_78;
- if (L_79)
- {
- G_B30_0 = _stringLiteral1482132450;
- G_B30_1 = ((int32_t)-2);
- G_B30_2 = L_78;
- goto IL_0290;
- }
- }
- {
- intptr_t L_80 = (intptr_t)UnityEngineVector2Wrap__g_get_magnitude_m1920742942_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_81 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_81, NULL, L_80, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheE_14(L_81);
- G_B30_0 = G_B29_0;
- G_B30_1 = G_B29_1;
- G_B30_2 = G_B29_2;
- }
- IL_0290:
- {
- lua_CSFunction_t883524059 * L_82 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheE_14();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B30_2, G_B30_1, G_B30_0, L_82, /*hidden argument*/NULL);
- intptr_t L_83 = ___L0;
- lua_CSFunction_t883524059 * L_84 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- G_B31_0 = _stringLiteral377862080;
- G_B31_1 = ((int32_t)-2);
- G_B31_2 = L_83;
- if (L_84)
- {
- G_B32_0 = _stringLiteral377862080;
- G_B32_1 = ((int32_t)-2);
- G_B32_2 = L_83;
- goto IL_02ba;
- }
- }
- {
- intptr_t L_85 = (intptr_t)UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_86 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_86, NULL, L_85, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cacheF_15(L_86);
- G_B32_0 = G_B31_0;
- G_B32_1 = G_B31_1;
- G_B32_2 = G_B31_2;
- }
- IL_02ba:
- {
- lua_CSFunction_t883524059 * L_87 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cacheF_15();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B32_2, G_B32_1, G_B32_0, L_87, /*hidden argument*/NULL);
- intptr_t L_88 = ___L0;
- lua_CSFunction_t883524059 * L_89 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- G_B33_0 = _stringLiteral3452614616;
- G_B33_1 = ((int32_t)-2);
- G_B33_2 = L_88;
- if (L_89)
- {
- G_B34_0 = _stringLiteral3452614616;
- G_B34_1 = ((int32_t)-2);
- G_B34_2 = L_88;
- goto IL_02e4;
- }
- }
- {
- intptr_t L_90 = (intptr_t)UnityEngineVector2Wrap__g_get_x_m4147433016_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_91 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_91, NULL, L_90, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache10_16(L_91);
- G_B34_0 = G_B33_0;
- G_B34_1 = G_B33_1;
- G_B34_2 = G_B33_2;
- }
- IL_02e4:
- {
- lua_CSFunction_t883524059 * L_92 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache10_16();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B34_2, G_B34_1, G_B34_0, L_92, /*hidden argument*/NULL);
- intptr_t L_93 = ___L0;
- lua_CSFunction_t883524059 * L_94 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- G_B35_0 = _stringLiteral3452614615;
- G_B35_1 = ((int32_t)-2);
- G_B35_2 = L_93;
- if (L_94)
- {
- G_B36_0 = _stringLiteral3452614615;
- G_B36_1 = ((int32_t)-2);
- G_B36_2 = L_93;
- goto IL_030e;
- }
- }
- {
- intptr_t L_95 = (intptr_t)UnityEngineVector2Wrap__g_get_y_m2714693255_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_96 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_96, NULL, L_95, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache11_17(L_96);
- G_B36_0 = G_B35_0;
- G_B36_1 = G_B35_1;
- G_B36_2 = G_B35_2;
- }
- IL_030e:
- {
- lua_CSFunction_t883524059 * L_97 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache11_17();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B36_2, G_B36_1, G_B36_0, L_97, /*hidden argument*/NULL);
- intptr_t L_98 = ___L0;
- lua_CSFunction_t883524059 * L_99 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache12_18();
- G_B37_0 = _stringLiteral3452614616;
- G_B37_1 = (-1);
- G_B37_2 = L_98;
- if (L_99)
- {
- G_B38_0 = _stringLiteral3452614616;
- G_B38_1 = (-1);
- G_B38_2 = L_98;
- goto IL_0337;
- }
- }
- {
- intptr_t L_100 = (intptr_t)UnityEngineVector2Wrap__s_set_x_m2341483890_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_101 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_101, NULL, L_100, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache12_18(L_101);
- G_B38_0 = G_B37_0;
- G_B38_1 = G_B37_1;
- G_B38_2 = G_B37_2;
- }
- IL_0337:
- {
- lua_CSFunction_t883524059 * L_102 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache12_18();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B38_2, G_B38_1, G_B38_0, L_102, /*hidden argument*/NULL);
- intptr_t L_103 = ___L0;
- lua_CSFunction_t883524059 * L_104 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache13_19();
- G_B39_0 = _stringLiteral3452614615;
- G_B39_1 = (-1);
- G_B39_2 = L_103;
- if (L_104)
- {
- G_B40_0 = _stringLiteral3452614615;
- G_B40_1 = (-1);
- G_B40_2 = L_103;
- goto IL_0360;
- }
- }
- {
- intptr_t L_105 = (intptr_t)UnityEngineVector2Wrap__s_set_y_m3798992961_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_106 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_106, NULL, L_105, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache13_19(L_106);
- G_B40_0 = G_B39_0;
- G_B40_1 = G_B39_1;
- G_B40_2 = G_B39_2;
- }
- IL_0360:
- {
- lua_CSFunction_t883524059 * L_107 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache13_19();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B40_2, G_B40_1, G_B40_0, L_107, /*hidden argument*/NULL);
- Type_t * L_108 = V_1;
- intptr_t L_109 = ___L0;
- ObjectTranslator_t2020767555 * L_110 = V_0;
- lua_CSFunction_t883524059 * L_111 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache14_20();
- G_B41_0 = L_110;
- G_B41_1 = L_109;
- G_B41_2 = L_108;
- if (L_111)
- {
- G_B42_0 = L_110;
- G_B42_1 = L_109;
- G_B42_2 = L_108;
- goto IL_0385;
- }
- }
- {
- intptr_t L_112 = (intptr_t)UnityEngineVector2Wrap___CSIndexer_m1160094481_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_113 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_113, NULL, L_112, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache14_20(L_113);
- G_B42_0 = G_B41_0;
- G_B42_1 = G_B41_1;
- G_B42_2 = G_B41_2;
- }
- IL_0385:
- {
- lua_CSFunction_t883524059 * L_114 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache14_20();
- lua_CSFunction_t883524059 * L_115 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache15_21();
- G_B43_0 = L_114;
- G_B43_1 = G_B42_0;
- G_B43_2 = G_B42_1;
- G_B43_3 = G_B42_2;
- if (L_115)
- {
- G_B44_0 = L_114;
- G_B44_1 = G_B42_0;
- G_B44_2 = G_B42_1;
- G_B44_3 = G_B42_2;
- goto IL_03a2;
- }
- }
- {
- intptr_t L_116 = (intptr_t)UnityEngineVector2Wrap___NewIndexer_m2412137810_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_117 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_117, NULL, L_116, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache15_21(L_117);
- G_B44_0 = G_B43_0;
- G_B44_1 = G_B43_1;
- G_B44_2 = G_B43_2;
- G_B44_3 = G_B43_3;
- }
- IL_03a2:
- {
- lua_CSFunction_t883524059 * L_118 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache15_21();
- Utils_EndObjectRegister_m3642684994(NULL /*static, unused*/, G_B44_3, G_B44_2, G_B44_1, G_B44_0, L_118, (Type_t *)NULL, (lua_CSFunction_t883524059 *)NULL, (lua_CSFunction_t883524059 *)NULL, /*hidden argument*/NULL);
- Type_t * L_119 = V_1;
- intptr_t L_120 = ___L0;
- lua_CSFunction_t883524059 * L_121 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache16_22();
- G_B45_0 = L_120;
- G_B45_1 = L_119;
- if (L_121)
- {
- G_B46_0 = L_120;
- G_B46_1 = L_119;
- goto IL_03c9;
- }
- }
- {
- intptr_t L_122 = (intptr_t)UnityEngineVector2Wrap___CreateInstance_m3609981491_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_123 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_123, NULL, L_122, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache16_22(L_123);
- G_B46_0 = G_B45_0;
- G_B46_1 = G_B45_1;
- }
- IL_03c9:
- {
- lua_CSFunction_t883524059 * L_124 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache16_22();
- Utils_BeginClassRegister_m3630094254(NULL /*static, unused*/, G_B46_1, G_B46_0, L_124, ((int32_t)16), 8, 0, /*hidden argument*/NULL);
- intptr_t L_125 = ___L0;
- lua_CSFunction_t883524059 * L_126 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache17_23();
- G_B47_0 = _stringLiteral1976572404;
- G_B47_1 = ((int32_t)-4);
- G_B47_2 = L_125;
- if (L_126)
- {
- G_B48_0 = _stringLiteral1976572404;
- G_B48_1 = ((int32_t)-4);
- G_B48_2 = L_125;
- goto IL_03f7;
- }
- }
- {
- intptr_t L_127 = (intptr_t)UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_128 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_128, NULL, L_127, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache17_23(L_128);
- G_B48_0 = G_B47_0;
- G_B48_1 = G_B47_1;
- G_B48_2 = G_B47_2;
- }
- IL_03f7:
- {
- lua_CSFunction_t883524059 * L_129 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache17_23();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B48_2, G_B48_1, G_B48_0, L_129, /*hidden argument*/NULL);
- intptr_t L_130 = ___L0;
- lua_CSFunction_t883524059 * L_131 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache18_24();
- G_B49_0 = _stringLiteral1522248929;
- G_B49_1 = ((int32_t)-4);
- G_B49_2 = L_130;
- if (L_131)
- {
- G_B50_0 = _stringLiteral1522248929;
- G_B50_1 = ((int32_t)-4);
- G_B50_2 = L_130;
- goto IL_0421;
- }
- }
- {
- intptr_t L_132 = (intptr_t)UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_133 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_133, NULL, L_132, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache18_24(L_133);
- G_B50_0 = G_B49_0;
- G_B50_1 = G_B49_1;
- G_B50_2 = G_B49_2;
- }
- IL_0421:
- {
- lua_CSFunction_t883524059 * L_134 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache18_24();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B50_2, G_B50_1, G_B50_0, L_134, /*hidden argument*/NULL);
- intptr_t L_135 = ___L0;
- lua_CSFunction_t883524059 * L_136 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache19_25();
- G_B51_0 = _stringLiteral2715533145;
- G_B51_1 = ((int32_t)-4);
- G_B51_2 = L_135;
- if (L_136)
- {
- G_B52_0 = _stringLiteral2715533145;
- G_B52_1 = ((int32_t)-4);
- G_B52_2 = L_135;
- goto IL_044b;
- }
- }
- {
- intptr_t L_137 = (intptr_t)UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_138 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_138, NULL, L_137, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache19_25(L_138);
- G_B52_0 = G_B51_0;
- G_B52_1 = G_B51_1;
- G_B52_2 = G_B51_2;
- }
- IL_044b:
- {
- lua_CSFunction_t883524059 * L_139 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache19_25();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B52_2, G_B52_1, G_B52_0, L_139, /*hidden argument*/NULL);
- intptr_t L_140 = ___L0;
- lua_CSFunction_t883524059 * L_141 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1A_26();
- G_B53_0 = _stringLiteral763145517;
- G_B53_1 = ((int32_t)-4);
- G_B53_2 = L_140;
- if (L_141)
- {
- G_B54_0 = _stringLiteral763145517;
- G_B54_1 = ((int32_t)-4);
- G_B54_2 = L_140;
- goto IL_0475;
- }
- }
- {
- intptr_t L_142 = (intptr_t)UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_143 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_143, NULL, L_142, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1A_26(L_143);
- G_B54_0 = G_B53_0;
- G_B54_1 = G_B53_1;
- G_B54_2 = G_B53_2;
- }
- IL_0475:
- {
- lua_CSFunction_t883524059 * L_144 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1A_26();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B54_2, G_B54_1, G_B54_0, L_144, /*hidden argument*/NULL);
- intptr_t L_145 = ___L0;
- lua_CSFunction_t883524059 * L_146 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1B_27();
- G_B55_0 = _stringLiteral1279211325;
- G_B55_1 = ((int32_t)-4);
- G_B55_2 = L_145;
- if (L_146)
- {
- G_B56_0 = _stringLiteral1279211325;
- G_B56_1 = ((int32_t)-4);
- G_B56_2 = L_145;
- goto IL_049f;
- }
- }
- {
- intptr_t L_147 = (intptr_t)UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_148 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_148, NULL, L_147, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1B_27(L_148);
- G_B56_0 = G_B55_0;
- G_B56_1 = G_B55_1;
- G_B56_2 = G_B55_2;
- }
- IL_049f:
- {
- lua_CSFunction_t883524059 * L_149 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1B_27();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B56_2, G_B56_1, G_B56_0, L_149, /*hidden argument*/NULL);
- intptr_t L_150 = ___L0;
- lua_CSFunction_t883524059 * L_151 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1C_28();
- G_B57_0 = _stringLiteral2553611042;
- G_B57_1 = ((int32_t)-4);
- G_B57_2 = L_150;
- if (L_151)
- {
- G_B58_0 = _stringLiteral2553611042;
- G_B58_1 = ((int32_t)-4);
- G_B58_2 = L_150;
- goto IL_04c9;
- }
- }
- {
- intptr_t L_152 = (intptr_t)UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_153 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_153, NULL, L_152, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1C_28(L_153);
- G_B58_0 = G_B57_0;
- G_B58_1 = G_B57_1;
- G_B58_2 = G_B57_2;
- }
- IL_04c9:
- {
- lua_CSFunction_t883524059 * L_154 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1C_28();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B58_2, G_B58_1, G_B58_0, L_154, /*hidden argument*/NULL);
- intptr_t L_155 = ___L0;
- lua_CSFunction_t883524059 * L_156 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1D_29();
- G_B59_0 = _stringLiteral4262356921;
- G_B59_1 = ((int32_t)-4);
- G_B59_2 = L_155;
- if (L_156)
- {
- G_B60_0 = _stringLiteral4262356921;
- G_B60_1 = ((int32_t)-4);
- G_B60_2 = L_155;
- goto IL_04f3;
- }
- }
- {
- intptr_t L_157 = (intptr_t)UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_158 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_158, NULL, L_157, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1D_29(L_158);
- G_B60_0 = G_B59_0;
- G_B60_1 = G_B59_1;
- G_B60_2 = G_B59_2;
- }
- IL_04f3:
- {
- lua_CSFunction_t883524059 * L_159 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1D_29();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B60_2, G_B60_1, G_B60_0, L_159, /*hidden argument*/NULL);
- intptr_t L_160 = ___L0;
- lua_CSFunction_t883524059 * L_161 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1E_30();
- G_B61_0 = _stringLiteral96702336;
- G_B61_1 = ((int32_t)-4);
- G_B61_2 = L_160;
- if (L_161)
- {
- G_B62_0 = _stringLiteral96702336;
- G_B62_1 = ((int32_t)-4);
- G_B62_2 = L_160;
- goto IL_051d;
- }
- }
- {
- intptr_t L_162 = (intptr_t)UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_163 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_163, NULL, L_162, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1E_30(L_163);
- G_B62_0 = G_B61_0;
- G_B62_1 = G_B61_1;
- G_B62_2 = G_B61_2;
- }
- IL_051d:
- {
- lua_CSFunction_t883524059 * L_164 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1E_30();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B62_2, G_B62_1, G_B62_0, L_164, /*hidden argument*/NULL);
- intptr_t L_165 = ___L0;
- lua_CSFunction_t883524059 * L_166 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1F_31();
- G_B63_0 = _stringLiteral3883988357;
- G_B63_1 = ((int32_t)-4);
- G_B63_2 = L_165;
- if (L_166)
- {
- G_B64_0 = _stringLiteral3883988357;
- G_B64_1 = ((int32_t)-4);
- G_B64_2 = L_165;
- goto IL_0547;
- }
- }
- {
- intptr_t L_167 = (intptr_t)UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_168 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_168, NULL, L_167, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache1F_31(L_168);
- G_B64_0 = G_B63_0;
- G_B64_1 = G_B63_1;
- G_B64_2 = G_B63_2;
- }
- IL_0547:
- {
- lua_CSFunction_t883524059 * L_169 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache1F_31();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B64_2, G_B64_1, G_B64_0, L_169, /*hidden argument*/NULL);
- intptr_t L_170 = ___L0;
- lua_CSFunction_t883524059 * L_171 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache20_32();
- G_B65_0 = _stringLiteral653878301;
- G_B65_1 = ((int32_t)-4);
- G_B65_2 = L_170;
- if (L_171)
- {
- G_B66_0 = _stringLiteral653878301;
- G_B66_1 = ((int32_t)-4);
- G_B66_2 = L_170;
- goto IL_0571;
- }
- }
- {
- intptr_t L_172 = (intptr_t)UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_173 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_173, NULL, L_172, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache20_32(L_173);
- G_B66_0 = G_B65_0;
- G_B66_1 = G_B65_1;
- G_B66_2 = G_B65_2;
- }
- IL_0571:
- {
- lua_CSFunction_t883524059 * L_174 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache20_32();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B66_2, G_B66_1, G_B66_0, L_174, /*hidden argument*/NULL);
- intptr_t L_175 = ___L0;
- lua_CSFunction_t883524059 * L_176 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache21_33();
- G_B67_0 = _stringLiteral377894624;
- G_B67_1 = ((int32_t)-4);
- G_B67_2 = L_175;
- if (L_176)
- {
- G_B68_0 = _stringLiteral377894624;
- G_B68_1 = ((int32_t)-4);
- G_B68_2 = L_175;
- goto IL_059b;
- }
- }
- {
- intptr_t L_177 = (intptr_t)UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_178 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_178, NULL, L_177, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache21_33(L_178);
- G_B68_0 = G_B67_0;
- G_B68_1 = G_B67_1;
- G_B68_2 = G_B67_2;
- }
- IL_059b:
- {
- lua_CSFunction_t883524059 * L_179 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache21_33();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B68_2, G_B68_1, G_B68_0, L_179, /*hidden argument*/NULL);
- intptr_t L_180 = ___L0;
- lua_CSFunction_t883524059 * L_181 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache22_34();
- G_B69_0 = _stringLiteral4073034039;
- G_B69_1 = ((int32_t)-4);
- G_B69_2 = L_180;
- if (L_181)
- {
- G_B70_0 = _stringLiteral4073034039;
- G_B70_1 = ((int32_t)-4);
- G_B70_2 = L_180;
- goto IL_05c5;
- }
- }
- {
- intptr_t L_182 = (intptr_t)UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_183 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_183, NULL, L_182, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache22_34(L_183);
- G_B70_0 = G_B69_0;
- G_B70_1 = G_B69_1;
- G_B70_2 = G_B69_2;
- }
- IL_05c5:
- {
- lua_CSFunction_t883524059 * L_184 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache22_34();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B70_2, G_B70_1, G_B70_0, L_184, /*hidden argument*/NULL);
- intptr_t L_185 = ___L0;
- lua_CSFunction_t883524059 * L_186 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache23_35();
- G_B71_0 = _stringLiteral4166618085;
- G_B71_1 = ((int32_t)-4);
- G_B71_2 = L_185;
- if (L_186)
- {
- G_B72_0 = _stringLiteral4166618085;
- G_B72_1 = ((int32_t)-4);
- G_B72_2 = L_185;
- goto IL_05ef;
- }
- }
- {
- intptr_t L_187 = (intptr_t)UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_188 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_188, NULL, L_187, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache23_35(L_188);
- G_B72_0 = G_B71_0;
- G_B72_1 = G_B71_1;
- G_B72_2 = G_B71_2;
- }
- IL_05ef:
- {
- lua_CSFunction_t883524059 * L_189 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache23_35();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B72_2, G_B72_1, G_B72_0, L_189, /*hidden argument*/NULL);
- intptr_t L_190 = ___L0;
- lua_CSFunction_t883524059 * L_191 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache24_36();
- G_B73_0 = _stringLiteral1734049320;
- G_B73_1 = ((int32_t)-4);
- G_B73_2 = L_190;
- if (L_191)
- {
- G_B74_0 = _stringLiteral1734049320;
- G_B74_1 = ((int32_t)-4);
- G_B74_2 = L_190;
- goto IL_0619;
- }
- }
- {
- intptr_t L_192 = (intptr_t)UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_193 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_193, NULL, L_192, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache24_36(L_193);
- G_B74_0 = G_B73_0;
- G_B74_1 = G_B73_1;
- G_B74_2 = G_B73_2;
- }
- IL_0619:
- {
- lua_CSFunction_t883524059 * L_194 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache24_36();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B74_2, G_B74_1, G_B74_0, L_194, /*hidden argument*/NULL);
- intptr_t L_195 = ___L0;
- ObjectTranslator_t2020767555 * L_196 = V_0;
- float L_197 = (1.0E-05f);
- RuntimeObject * L_198 = Box(Single_t1397266774_il2cpp_TypeInfo_var, &L_197);
- Utils_RegisterObject_m691522261(NULL /*static, unused*/, L_195, L_196, ((int32_t)-4), _stringLiteral3580117429, L_198, /*hidden argument*/NULL);
- intptr_t L_199 = ___L0;
- lua_CSFunction_t883524059 * L_200 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache25_37();
- G_B75_0 = _stringLiteral1256528358;
- G_B75_1 = ((int32_t)-2);
- G_B75_2 = L_199;
- if (L_200)
- {
- G_B76_0 = _stringLiteral1256528358;
- G_B76_1 = ((int32_t)-2);
- G_B76_2 = L_199;
- goto IL_065b;
- }
- }
- {
- intptr_t L_201 = (intptr_t)UnityEngineVector2Wrap__g_get_zero_m4234870038_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_202 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_202, NULL, L_201, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache25_37(L_202);
- G_B76_0 = G_B75_0;
- G_B76_1 = G_B75_1;
- G_B76_2 = G_B75_2;
- }
- IL_065b:
- {
- lua_CSFunction_t883524059 * L_203 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache25_37();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B76_2, G_B76_1, G_B76_0, L_203, /*hidden argument*/NULL);
- intptr_t L_204 = ___L0;
- lua_CSFunction_t883524059 * L_205 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache26_38();
- G_B77_0 = _stringLiteral1700053330;
- G_B77_1 = ((int32_t)-2);
- G_B77_2 = L_204;
- if (L_205)
- {
- G_B78_0 = _stringLiteral1700053330;
- G_B78_1 = ((int32_t)-2);
- G_B78_2 = L_204;
- goto IL_0685;
- }
- }
- {
- intptr_t L_206 = (intptr_t)UnityEngineVector2Wrap__g_get_one_m1876688525_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_207 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_207, NULL, L_206, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache26_38(L_207);
- G_B78_0 = G_B77_0;
- G_B78_1 = G_B77_1;
- G_B78_2 = G_B77_2;
- }
- IL_0685:
- {
- lua_CSFunction_t883524059 * L_208 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache26_38();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B78_2, G_B78_1, G_B78_0, L_208, /*hidden argument*/NULL);
- intptr_t L_209 = ___L0;
- lua_CSFunction_t883524059 * L_210 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache27_39();
- G_B79_0 = _stringLiteral3455760331;
- G_B79_1 = ((int32_t)-2);
- G_B79_2 = L_209;
- if (L_210)
- {
- G_B80_0 = _stringLiteral3455760331;
- G_B80_1 = ((int32_t)-2);
- G_B80_2 = L_209;
- goto IL_06af;
- }
- }
- {
- intptr_t L_211 = (intptr_t)UnityEngineVector2Wrap__g_get_up_m2923378165_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_212 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_212, NULL, L_211, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache27_39(L_212);
- G_B80_0 = G_B79_0;
- G_B80_1 = G_B79_1;
- G_B80_2 = G_B79_2;
- }
- IL_06af:
- {
- lua_CSFunction_t883524059 * L_213 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache27_39();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B80_2, G_B80_1, G_B80_0, L_213, /*hidden argument*/NULL);
- intptr_t L_214 = ___L0;
- lua_CSFunction_t883524059 * L_215 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache28_40();
- G_B81_0 = _stringLiteral60121299;
- G_B81_1 = ((int32_t)-2);
- G_B81_2 = L_214;
- if (L_215)
- {
- G_B82_0 = _stringLiteral60121299;
- G_B82_1 = ((int32_t)-2);
- G_B82_2 = L_214;
- goto IL_06d9;
- }
- }
- {
- intptr_t L_216 = (intptr_t)UnityEngineVector2Wrap__g_get_down_m2946352740_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_217 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_217, NULL, L_216, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache28_40(L_217);
- G_B82_0 = G_B81_0;
- G_B82_1 = G_B81_1;
- G_B82_2 = G_B81_2;
- }
- IL_06d9:
- {
- lua_CSFunction_t883524059 * L_218 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache28_40();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B82_2, G_B82_1, G_B82_0, L_218, /*hidden argument*/NULL);
- intptr_t L_219 = ___L0;
- lua_CSFunction_t883524059 * L_220 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache29_41();
- G_B83_0 = _stringLiteral4249957872;
- G_B83_1 = ((int32_t)-2);
- G_B83_2 = L_219;
- if (L_220)
- {
- G_B84_0 = _stringLiteral4249957872;
- G_B84_1 = ((int32_t)-2);
- G_B84_2 = L_219;
- goto IL_0703;
- }
- }
- {
- intptr_t L_221 = (intptr_t)UnityEngineVector2Wrap__g_get_left_m158211399_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_222 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_222, NULL, L_221, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache29_41(L_222);
- G_B84_0 = G_B83_0;
- G_B84_1 = G_B83_1;
- G_B84_2 = G_B83_2;
- }
- IL_0703:
- {
- lua_CSFunction_t883524059 * L_223 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache29_41();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B84_2, G_B84_1, G_B84_0, L_223, /*hidden argument*/NULL);
- intptr_t L_224 = ___L0;
- lua_CSFunction_t883524059 * L_225 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2A_42();
- G_B85_0 = _stringLiteral742876383;
- G_B85_1 = ((int32_t)-2);
- G_B85_2 = L_224;
- if (L_225)
- {
- G_B86_0 = _stringLiteral742876383;
- G_B86_1 = ((int32_t)-2);
- G_B86_2 = L_224;
- goto IL_072d;
- }
- }
- {
- intptr_t L_226 = (intptr_t)UnityEngineVector2Wrap__g_get_right_m77832184_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_227 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_227, NULL, L_226, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2A_42(L_227);
- G_B86_0 = G_B85_0;
- G_B86_1 = G_B85_1;
- G_B86_2 = G_B85_2;
- }
- IL_072d:
- {
- lua_CSFunction_t883524059 * L_228 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2A_42();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B86_2, G_B86_1, G_B86_0, L_228, /*hidden argument*/NULL);
- intptr_t L_229 = ___L0;
- lua_CSFunction_t883524059 * L_230 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2B_43();
- G_B87_0 = _stringLiteral1269054116;
- G_B87_1 = ((int32_t)-2);
- G_B87_2 = L_229;
- if (L_230)
- {
- G_B88_0 = _stringLiteral1269054116;
- G_B88_1 = ((int32_t)-2);
- G_B88_2 = L_229;
- goto IL_0757;
- }
- }
- {
- intptr_t L_231 = (intptr_t)UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_232 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_232, NULL, L_231, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2B_43(L_232);
- G_B88_0 = G_B87_0;
- G_B88_1 = G_B87_1;
- G_B88_2 = G_B87_2;
- }
- IL_0757:
- {
- lua_CSFunction_t883524059 * L_233 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2B_43();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B88_2, G_B88_1, G_B88_0, L_233, /*hidden argument*/NULL);
- intptr_t L_234 = ___L0;
- lua_CSFunction_t883524059 * L_235 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2C_44();
- G_B89_0 = _stringLiteral1769437942;
- G_B89_1 = ((int32_t)-2);
- G_B89_2 = L_234;
- if (L_235)
- {
- G_B90_0 = _stringLiteral1769437942;
- G_B90_1 = ((int32_t)-2);
- G_B90_2 = L_234;
- goto IL_0781;
- }
- }
- {
- intptr_t L_236 = (intptr_t)UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575_RuntimeMethod_var;
- lua_CSFunction_t883524059 * L_237 = (lua_CSFunction_t883524059 *)il2cpp_codegen_object_new(lua_CSFunction_t883524059_il2cpp_TypeInfo_var);
- lua_CSFunction__ctor_m2895663127(L_237, NULL, L_236, /*hidden argument*/NULL);
- ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->set_U3CU3Ef__mgU24cache2C_44(L_237);
- G_B90_0 = G_B89_0;
- G_B90_1 = G_B89_1;
- G_B90_2 = G_B89_2;
- }
- IL_0781:
- {
- lua_CSFunction_t883524059 * L_238 = ((UnityEngineVector2Wrap_t2602506976_StaticFields*)il2cpp_codegen_static_fields_for(UnityEngineVector2Wrap_t2602506976_il2cpp_TypeInfo_var))->get_U3CU3Ef__mgU24cache2C_44();
- Utils_RegisterFunc_m1228226546(NULL /*static, unused*/, G_B90_2, G_B90_1, G_B90_0, L_238, /*hidden argument*/NULL);
- Type_t * L_239 = V_1;
- intptr_t L_240 = ___L0;
- ObjectTranslator_t2020767555 * L_241 = V_0;
- Utils_EndClassRegister_m1460189367(NULL /*static, unused*/, L_239, L_240, L_241, /*hidden argument*/NULL);
- return;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__CreateInstance(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___CreateInstance_m3609981491 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___CreateInstance_m3609981491_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- float V_1 = 0.0f;
- float V_2 = 0.0f;
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Vector2_t2156229523 V_5;
- memset(&V_5, 0, sizeof(V_5));
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- intptr_t L_3 = ___L0;
- int32_t L_4 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_4) == ((uint32_t)3))))
- {
- goto IL_005d;
- }
- }
- IL_0018:
- {
- intptr_t L_5 = ___L0;
- int32_t L_6 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_5, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_6) == ((uint32_t)3))))
- {
- goto IL_005d;
- }
- }
- IL_0025:
- {
- intptr_t L_7 = ___L0;
- int32_t L_8 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_7, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_8) == ((uint32_t)3))))
- {
- goto IL_005d;
- }
- }
- IL_0032:
- {
- intptr_t L_9 = ___L0;
- double L_10 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_9, 2, /*hidden argument*/NULL);
- V_1 = (((float)((float)L_10)));
- intptr_t L_11 = ___L0;
- double L_12 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_11, 3, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_12)));
- float L_13 = V_1;
- float L_14 = V_2;
- Vector2__ctor_m3970636864((&V_3), L_13, L_14, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_15 = V_0;
- intptr_t L_16 = ___L0;
- Vector2_t2156229523 L_17 = V_3;
- NullCheck(L_15);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_15, L_16, L_17, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00ae;
- }
- IL_005d:
- {
- intptr_t L_18 = ___L0;
- int32_t L_19 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_18, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_19) == ((uint32_t)1))))
- {
- goto IL_0082;
- }
- }
- IL_0069:
- {
- ObjectTranslator_t2020767555 * L_20 = V_0;
- intptr_t L_21 = ___L0;
- il2cpp_codegen_initobj((&V_5), sizeof(Vector2_t2156229523 ));
- Vector2_t2156229523 L_22 = V_5;
- NullCheck(L_20);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_20, L_21, L_22, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00ae;
- }
- IL_0082:
- {
- goto IL_00a2;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0087;
- throw e;
- }
- CATCH_0087:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_23 = ___L0;
- Exception_t * L_24 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_25 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_24, /*hidden argument*/NULL);
- int32_t L_26 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_23, L_25, /*hidden argument*/NULL);
- V_4 = L_26;
- goto IL_00ae;
- } // end catch (depth: 1)
- IL_00a2:
- {
- intptr_t L_27 = ___L0;
- int32_t L_28 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_27, _stringLiteral3699549820, /*hidden argument*/NULL);
- return L_28;
- }
- IL_00ae:
- {
- int32_t L_29 = V_4;
- return L_29;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__CSIndexer(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___CSIndexer_m1160094481 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___CSIndexer_m1160094481_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- int32_t V_2 = 0;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_0055;
- }
- }
- IL_0019:
- {
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_7) == ((uint32_t)3))))
- {
- goto IL_0055;
- }
- }
- IL_0026:
- {
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- NullCheck(L_8);
- ObjectTranslator_Get_m1627229422(L_8, L_9, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_10 = ___L0;
- int32_t L_11 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_10, 2, /*hidden argument*/NULL);
- V_2 = L_11;
- intptr_t L_12 = ___L0;
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_12, (bool)1, /*hidden argument*/NULL);
- intptr_t L_13 = ___L0;
- int32_t L_14 = V_2;
- float L_15 = Vector2_get_Item_m3559215723((&V_1), L_14, /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_13, (((double)((double)L_15))), /*hidden argument*/NULL);
- V_3 = 2;
- goto IL_007d;
- }
- IL_0055:
- {
- goto IL_0074;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_005a;
- throw e;
- }
- CATCH_005a:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_3 = L_19;
- goto IL_007d;
- } // end catch (depth: 1)
- IL_0074:
- {
- intptr_t L_20 = ___L0;
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_20, (bool)0, /*hidden argument*/NULL);
- return 1;
- }
- IL_007d:
- {
- int32_t L_21 = V_3;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__NewIndexer(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___NewIndexer_m2412137810 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___NewIndexer_m2412137810_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- int32_t V_2 = 0;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- }
- IL_000c:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_0063;
- }
- }
- IL_0019:
- {
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_7) == ((uint32_t)3))))
- {
- goto IL_0063;
- }
- }
- IL_0026:
- {
- intptr_t L_8 = ___L0;
- int32_t L_9 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_8, 3, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_9) == ((uint32_t)3))))
- {
- goto IL_0063;
- }
- }
- IL_0033:
- {
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- NullCheck(L_10);
- ObjectTranslator_Get_m1627229422(L_10, L_11, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_12 = ___L0;
- int32_t L_13 = Lua_xlua_tointeger_m2263761157(NULL /*static, unused*/, L_12, 2, /*hidden argument*/NULL);
- V_2 = L_13;
- int32_t L_14 = V_2;
- intptr_t L_15 = ___L0;
- double L_16 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_15, 3, /*hidden argument*/NULL);
- Vector2_set_Item_m3557490725((&V_1), L_14, (((float)((float)L_16))), /*hidden argument*/NULL);
- intptr_t L_17 = ___L0;
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_17, (bool)1, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_008b;
- }
- IL_0063:
- {
- goto IL_0082;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0068;
- throw e;
- }
- CATCH_0068:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_18 = ___L0;
- Exception_t * L_19 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_20 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_19, /*hidden argument*/NULL);
- int32_t L_21 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_18, L_20, /*hidden argument*/NULL);
- V_3 = L_21;
- goto IL_008b;
- } // end catch (depth: 1)
- IL_0082:
- {
- intptr_t L_22 = ___L0;
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_22, (bool)0, /*hidden argument*/NULL);
- return 1;
- }
- IL_008b:
- {
- int32_t L_23 = V_3;
- return L_23;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__AddMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___AddMeta_m377273840 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___AddMeta_m377273840_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_004f;
- }
- }
- IL_0019:
- {
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- bool L_8 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_6, L_7, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_8)
- {
- goto IL_004f;
- }
- }
- IL_0026:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- ObjectTranslator_Get_m1627229422(L_9, L_10, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- NullCheck(L_11);
- ObjectTranslator_Get_m1627229422(L_11, L_12, 2, (&V_2), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_13 = V_0;
- intptr_t L_14 = ___L0;
- Vector2_t2156229523 L_15 = V_1;
- Vector2_t2156229523 L_16 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_17 = Vector2_op_Addition_m800700293(NULL /*static, unused*/, L_15, L_16, /*hidden argument*/NULL);
- NullCheck(L_13);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_13, L_14, L_17, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_007a;
- }
- IL_004f:
- {
- goto IL_006e;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0054;
- throw e;
- }
- CATCH_0054:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_18 = ___L0;
- Exception_t * L_19 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_20 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_19, /*hidden argument*/NULL);
- int32_t L_21 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_18, L_20, /*hidden argument*/NULL);
- V_3 = L_21;
- goto IL_007a;
- } // end catch (depth: 1)
- IL_006e:
- {
- intptr_t L_22 = ___L0;
- int32_t L_23 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_22, _stringLiteral4081218855, /*hidden argument*/NULL);
- return L_23;
- }
- IL_007a:
- {
- int32_t L_24 = V_3;
- return L_24;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__SubMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___SubMeta_m2441875035 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___SubMeta_m2441875035_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_004f;
- }
- }
- IL_0019:
- {
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- bool L_8 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_6, L_7, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_8)
- {
- goto IL_004f;
- }
- }
- IL_0026:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- ObjectTranslator_Get_m1627229422(L_9, L_10, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- NullCheck(L_11);
- ObjectTranslator_Get_m1627229422(L_11, L_12, 2, (&V_2), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_13 = V_0;
- intptr_t L_14 = ___L0;
- Vector2_t2156229523 L_15 = V_1;
- Vector2_t2156229523 L_16 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_17 = Vector2_op_Subtraction_m73004381(NULL /*static, unused*/, L_15, L_16, /*hidden argument*/NULL);
- NullCheck(L_13);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_13, L_14, L_17, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_007a;
- }
- IL_004f:
- {
- goto IL_006e;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0054;
- throw e;
- }
- CATCH_0054:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_18 = ___L0;
- Exception_t * L_19 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_20 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_19, /*hidden argument*/NULL);
- int32_t L_21 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_18, L_20, /*hidden argument*/NULL);
- V_3 = L_21;
- goto IL_007a;
- } // end catch (depth: 1)
- IL_006e:
- {
- intptr_t L_22 = ___L0;
- int32_t L_23 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_22, _stringLiteral3789986232, /*hidden argument*/NULL);
- return L_23;
- }
- IL_007a:
- {
- int32_t L_24 = V_3;
- return L_24;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__UnmMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___UnmMeta_m4167622536 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___UnmMeta_m4167622536_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- }
- IL_000c:
- try
- { // begin try (depth: 1)
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- Vector2_t2156229523 L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_8 = Vector2_op_UnaryNegation_m2172448356(NULL /*static, unused*/, L_7, /*hidden argument*/NULL);
- NullCheck(L_5);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_5, L_6, L_8, /*hidden argument*/NULL);
- goto IL_0040;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0028;
- throw e;
- }
- CATCH_0028:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0042;
- } // end catch (depth: 1)
- IL_0040:
- {
- return 1;
- }
- IL_0042:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__MulMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___MulMeta_m3110680190 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___MulMeta_m3110680190_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- float V_2 = 0.0f;
- int32_t V_3 = 0;
- float V_4 = 0.0f;
- Vector2_t2156229523 V_5;
- memset(&V_5, 0, sizeof(V_5));
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_004e;
- }
- }
- IL_0019:
- {
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_7) == ((uint32_t)3))))
- {
- goto IL_004e;
- }
- }
- IL_0026:
- {
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- NullCheck(L_8);
- ObjectTranslator_Get_m1627229422(L_8, L_9, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_10 = ___L0;
- double L_11 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_10, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_11)));
- ObjectTranslator_t2020767555 * L_12 = V_0;
- intptr_t L_13 = ___L0;
- Vector2_t2156229523 L_14 = V_1;
- float L_15 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_16 = Vector2_op_Multiply_m2347887432(NULL /*static, unused*/, L_14, L_15, /*hidden argument*/NULL);
- NullCheck(L_12);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_12, L_13, L_16, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_00be;
- }
- IL_004e:
- {
- intptr_t L_17 = ___L0;
- int32_t L_18 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_17, 1, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_18) == ((uint32_t)3))))
- {
- goto IL_0093;
- }
- }
- IL_005b:
- {
- ObjectTranslator_t2020767555 * L_19 = V_0;
- intptr_t L_20 = ___L0;
- NullCheck(L_19);
- bool L_21 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_19, L_20, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_21)
- {
- goto IL_0093;
- }
- }
- IL_0068:
- {
- intptr_t L_22 = ___L0;
- double L_23 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_22, 1, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_23)));
- ObjectTranslator_t2020767555 * L_24 = V_0;
- intptr_t L_25 = ___L0;
- NullCheck(L_24);
- ObjectTranslator_Get_m1627229422(L_24, L_25, 2, (&V_5), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_26 = V_0;
- intptr_t L_27 = ___L0;
- float L_28 = V_4;
- Vector2_t2156229523 L_29 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_30 = Vector2_op_Multiply_m3294489634(NULL /*static, unused*/, L_28, L_29, /*hidden argument*/NULL);
- NullCheck(L_26);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_26, L_27, L_30, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_00be;
- }
- IL_0093:
- {
- goto IL_00b2;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0098;
- throw e;
- }
- CATCH_0098:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_31 = ___L0;
- Exception_t * L_32 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_33 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_32, /*hidden argument*/NULL);
- int32_t L_34 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_31, L_33, /*hidden argument*/NULL);
- V_3 = L_34;
- goto IL_00be;
- } // end catch (depth: 1)
- IL_00b2:
- {
- intptr_t L_35 = ___L0;
- int32_t L_36 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_35, _stringLiteral442136271, /*hidden argument*/NULL);
- return L_36;
- }
- IL_00be:
- {
- int32_t L_37 = V_3;
- return L_37;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__DivMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___DivMeta_m697562865 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___DivMeta_m697562865_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- float V_2 = 0.0f;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_004e;
- }
- }
- IL_0019:
- {
- intptr_t L_6 = ___L0;
- int32_t L_7 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_6, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_7) == ((uint32_t)3))))
- {
- goto IL_004e;
- }
- }
- IL_0026:
- {
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- NullCheck(L_8);
- ObjectTranslator_Get_m1627229422(L_8, L_9, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_10 = ___L0;
- double L_11 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_10, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_11)));
- ObjectTranslator_t2020767555 * L_12 = V_0;
- intptr_t L_13 = ___L0;
- Vector2_t2156229523 L_14 = V_1;
- float L_15 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_16 = Vector2_op_Division_m132623573(NULL /*static, unused*/, L_14, L_15, /*hidden argument*/NULL);
- NullCheck(L_12);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_12, L_13, L_16, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0079;
- }
- IL_004e:
- {
- goto IL_006d;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0053;
- throw e;
- }
- CATCH_0053:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_3 = L_20;
- goto IL_0079;
- } // end catch (depth: 1)
- IL_006d:
- {
- intptr_t L_21 = ___L0;
- int32_t L_22 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_21, _stringLiteral1864468633, /*hidden argument*/NULL);
- return L_22;
- }
- IL_0079:
- {
- int32_t L_23 = V_3;
- return L_23;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::__EqMeta(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap___EqMeta_m3842372935 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap___EqMeta_m3842372935_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- bool L_5 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_3, L_4, 1, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_5)
- {
- goto IL_004e;
- }
- }
- IL_0019:
- {
- ObjectTranslator_t2020767555 * L_6 = V_0;
- intptr_t L_7 = ___L0;
- NullCheck(L_6);
- bool L_8 = ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717(L_6, L_7, 2, /*hidden argument*/ObjectTranslator_Assignable_TisVector2_t2156229523_m271799717_RuntimeMethod_var);
- if (!L_8)
- {
- goto IL_004e;
- }
- }
- IL_0026:
- {
- ObjectTranslator_t2020767555 * L_9 = V_0;
- intptr_t L_10 = ___L0;
- NullCheck(L_9);
- ObjectTranslator_Get_m1627229422(L_9, L_10, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- NullCheck(L_11);
- ObjectTranslator_Get_m1627229422(L_11, L_12, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_13 = ___L0;
- Vector2_t2156229523 L_14 = V_1;
- Vector2_t2156229523 L_15 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- bool L_16 = Vector2_op_Equality_m2303255133(NULL /*static, unused*/, L_14, L_15, /*hidden argument*/NULL);
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_13, L_16, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0079;
- }
- IL_004e:
- {
- goto IL_006d;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0053;
- throw e;
- }
- CATCH_0053:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_3 = L_20;
- goto IL_0079;
- } // end catch (depth: 1)
- IL_006d:
- {
- intptr_t L_21 = ___L0;
- int32_t L_22 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_21, _stringLiteral1882008321, /*hidden argument*/NULL);
- return L_22;
- }
- IL_0079:
- {
- int32_t L_23 = V_3;
- return L_23;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Set(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Set_m4206157458 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Set_m4206157458_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- float V_2 = 0.0f;
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- double L_6 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_5, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_6)));
- intptr_t L_7 = ___L0;
- double L_8 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_7, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_8)));
- float L_9 = V_2;
- float L_10 = V_3;
- Vector2_Set_m3780194483((&V_1), L_9, L_10, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- Vector2_t2156229523 L_13 = V_1;
- NullCheck(L_11);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_11, L_12, 1, L_13, /*hidden argument*/NULL);
- V_4 = 0;
- goto IL_005d;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0042;
- throw e;
- }
- CATCH_0042:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_14 = ___L0;
- Exception_t * L_15 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_16 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_15, /*hidden argument*/NULL);
- int32_t L_17 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_14, L_16, /*hidden argument*/NULL);
- V_4 = L_17;
- goto IL_005d;
- } // end catch (depth: 1)
- IL_005d:
- {
- int32_t L_18 = V_4;
- return L_18;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Lerp_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Lerp_xlua_st__m2007667718_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- Vector2_t2156229523 V_4;
- memset(&V_4, 0, sizeof(V_4));
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_7 = ___L0;
- double L_8 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_7, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_8)));
- Vector2_t2156229523 L_9 = V_1;
- Vector2_t2156229523 L_10 = V_2;
- float L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_12 = Vector2_Lerp_m854472224(NULL /*static, unused*/, L_9, L_10, L_11, /*hidden argument*/NULL);
- V_4 = L_12;
- ObjectTranslator_t2020767555 * L_13 = V_0;
- intptr_t L_14 = ___L0;
- Vector2_t2156229523 L_15 = V_4;
- NullCheck(L_13);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_13, L_14, L_15, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_005f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0044;
- throw e;
- }
- CATCH_0044:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_5 = L_19;
- goto IL_005f;
- } // end catch (depth: 1)
- IL_005f:
- {
- int32_t L_20 = V_5;
- return L_20;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_LerpUnclamped_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_LerpUnclamped_xlua_st__m168302871_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- Vector2_t2156229523 V_4;
- memset(&V_4, 0, sizeof(V_4));
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_7 = ___L0;
- double L_8 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_7, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_8)));
- Vector2_t2156229523 L_9 = V_1;
- Vector2_t2156229523 L_10 = V_2;
- float L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_12 = Vector2_LerpUnclamped_m1574157890(NULL /*static, unused*/, L_9, L_10, L_11, /*hidden argument*/NULL);
- V_4 = L_12;
- ObjectTranslator_t2020767555 * L_13 = V_0;
- intptr_t L_14 = ___L0;
- Vector2_t2156229523 L_15 = V_4;
- NullCheck(L_13);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_13, L_14, L_15, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_005f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0044;
- throw e;
- }
- CATCH_0044:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_5 = L_19;
- goto IL_005f;
- } // end catch (depth: 1)
- IL_005f:
- {
- int32_t L_20 = V_5;
- return L_20;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_MoveTowards_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_MoveTowards_xlua_st__m3735720869_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- Vector2_t2156229523 V_4;
- memset(&V_4, 0, sizeof(V_4));
- int32_t V_5 = 0;
- Exception_t * V_6 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- intptr_t L_7 = ___L0;
- double L_8 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_7, 3, /*hidden argument*/NULL);
- V_3 = (((float)((float)L_8)));
- Vector2_t2156229523 L_9 = V_1;
- Vector2_t2156229523 L_10 = V_2;
- float L_11 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_12 = Vector2_MoveTowards_m456668783(NULL /*static, unused*/, L_9, L_10, L_11, /*hidden argument*/NULL);
- V_4 = L_12;
- ObjectTranslator_t2020767555 * L_13 = V_0;
- intptr_t L_14 = ___L0;
- Vector2_t2156229523 L_15 = V_4;
- NullCheck(L_13);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_13, L_14, L_15, /*hidden argument*/NULL);
- V_5 = 1;
- goto IL_005f;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0044;
- throw e;
- }
- CATCH_0044:
- { // begin catch(System.Exception)
- V_6 = ((Exception_t *)__exception_local);
- intptr_t L_16 = ___L0;
- Exception_t * L_17 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_18 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_17, /*hidden argument*/NULL);
- int32_t L_19 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_16, L_18, /*hidden argument*/NULL);
- V_5 = L_19;
- goto IL_005f;
- } // end catch (depth: 1)
- IL_005f:
- {
- int32_t L_20 = V_5;
- return L_20;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Scale_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Scale_xlua_st__m3348888867_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_9 = Vector2_Scale_m165605769(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- Vector2_t2156229523 L_12 = V_3;
- NullCheck(L_10);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Scale(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Scale_m3402797960 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Scale_m3402797960_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_2;
- Vector2_Scale_m4286416168((&V_1), L_7, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- Vector2_t2156229523 L_10 = V_1;
- NullCheck(L_8);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_8, L_9, 1, L_10, /*hidden argument*/NULL);
- V_3 = 0;
- goto IL_0052;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_11 = ___L0;
- Exception_t * L_12 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_13 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_12, /*hidden argument*/NULL);
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_11, L_13, /*hidden argument*/NULL);
- V_3 = L_14;
- goto IL_0052;
- } // end catch (depth: 1)
- IL_0052:
- {
- int32_t L_15 = V_3;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Normalize(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Normalize_m2064805032 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Normalize_m2064805032_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- int32_t V_2 = 0;
- Exception_t * V_3 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- Vector2_Normalize_m1906922873((&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- Vector2_t2156229523 L_7 = V_1;
- NullCheck(L_5);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_5, L_6, 1, L_7, /*hidden argument*/NULL);
- V_2 = 0;
- goto IL_0045;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002d;
- throw e;
- }
- CATCH_002d:
- { // begin catch(System.Exception)
- V_3 = ((Exception_t *)__exception_local);
- intptr_t L_8 = ___L0;
- Exception_t * L_9 = V_3;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_10 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_9, /*hidden argument*/NULL);
- int32_t L_11 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_8, L_10, /*hidden argument*/NULL);
- V_2 = L_11;
- goto IL_0045;
- } // end catch (depth: 1)
- IL_0045:
- {
- int32_t L_12 = V_2;
- return L_12;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_ToString(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_ToString_m3633924156 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_ToString_m3633924156_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- int32_t V_2 = 0;
- String_t* V_3 = NULL;
- int32_t V_4 = 0;
- String_t* V_5 = NULL;
- String_t* V_6 = NULL;
- Exception_t * V_7 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- {
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- int32_t L_6 = Lua_lua_gettop_m2394536141(NULL /*static, unused*/, L_5, /*hidden argument*/NULL);
- V_2 = L_6;
- int32_t L_7 = V_2;
- if ((!(((uint32_t)L_7) == ((uint32_t)1))))
- {
- goto IL_004a;
- }
- }
- IL_0024:
- {
- String_t* L_8 = Vector2_ToString_m1205609053((&V_1), /*hidden argument*/NULL);
- V_3 = L_8;
- intptr_t L_9 = ___L0;
- String_t* L_10 = V_3;
- Lua_lua_pushstring_m4067524778(NULL /*static, unused*/, L_9, L_10, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_11 = V_0;
- intptr_t L_12 = ___L0;
- Vector2_t2156229523 L_13 = V_1;
- NullCheck(L_11);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_11, L_12, 1, L_13, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00c3;
- }
- IL_004a:
- {
- int32_t L_14 = V_2;
- if ((!(((uint32_t)L_14) == ((uint32_t)2))))
- {
- goto IL_0097;
- }
- }
- IL_0051:
- {
- intptr_t L_15 = ___L0;
- bool L_16 = Lua_lua_isnil_m3293895152(NULL /*static, unused*/, L_15, 2, /*hidden argument*/NULL);
- if (L_16)
- {
- goto IL_006a;
- }
- }
- IL_005d:
- {
- intptr_t L_17 = ___L0;
- int32_t L_18 = Lua_lua_type_m1302598900(NULL /*static, unused*/, L_17, 2, /*hidden argument*/NULL);
- if ((!(((uint32_t)L_18) == ((uint32_t)4))))
- {
- goto IL_0097;
- }
- }
- IL_006a:
- {
- intptr_t L_19 = ___L0;
- String_t* L_20 = Lua_lua_tostring_m2201066917(NULL /*static, unused*/, L_19, 2, /*hidden argument*/NULL);
- V_5 = L_20;
- String_t* L_21 = V_5;
- String_t* L_22 = Vector2_ToString_m2296514517((&V_1), L_21, /*hidden argument*/NULL);
- V_6 = L_22;
- intptr_t L_23 = ___L0;
- String_t* L_24 = V_6;
- Lua_lua_pushstring_m4067524778(NULL /*static, unused*/, L_23, L_24, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_25 = V_0;
- intptr_t L_26 = ___L0;
- Vector2_t2156229523 L_27 = V_1;
- NullCheck(L_25);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_25, L_26, 1, L_27, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_00c3;
- }
- IL_0097:
- {
- goto IL_00b7;
- }
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_009c;
- throw e;
- }
- CATCH_009c:
- { // begin catch(System.Exception)
- V_7 = ((Exception_t *)__exception_local);
- intptr_t L_28 = ___L0;
- Exception_t * L_29 = V_7;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_30 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_29, /*hidden argument*/NULL);
- int32_t L_31 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_28, L_30, /*hidden argument*/NULL);
- V_4 = L_31;
- goto IL_00c3;
- } // end catch (depth: 1)
- IL_00b7:
- {
- intptr_t L_32 = ___L0;
- int32_t L_33 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_32, _stringLiteral3137284987, /*hidden argument*/NULL);
- return L_33;
- }
- IL_00c3:
- {
- int32_t L_34 = V_4;
- return L_34;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_GetHashCode(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_GetHashCode_m3805233334 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_GetHashCode_m3805233334_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- int32_t V_2 = 0;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- int32_t L_5 = Vector2_GetHashCode_m3916089713((&V_1), /*hidden argument*/NULL);
- V_2 = L_5;
- intptr_t L_6 = ___L0;
- int32_t L_7 = V_2;
- Lua_xlua_pushinteger_m3473749366(NULL /*static, unused*/, L_6, L_7, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- Vector2_t2156229523 L_10 = V_1;
- NullCheck(L_8);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_8, L_9, 1, L_10, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0055;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_003b;
- throw e;
- }
- CATCH_003b:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_11 = ___L0;
- Exception_t * L_12 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_13 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_12, /*hidden argument*/NULL);
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_11, L_13, /*hidden argument*/NULL);
- V_3 = L_14;
- goto IL_0055;
- } // end catch (depth: 1)
- IL_0055:
- {
- int32_t L_15 = V_3;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Equals(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Equals_m4260714512 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Equals_m4260714512_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- RuntimeObject * V_2 = NULL;
- bool V_3 = false;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- RuntimeTypeHandle_t3027515415 L_7 = { reinterpret_cast<intptr_t> (RuntimeObject_0_0_0_var) };
- IL2CPP_RUNTIME_CLASS_INIT(Type_t_il2cpp_TypeInfo_var);
- Type_t * L_8 = Type_GetTypeFromHandle_m1620074514(NULL /*static, unused*/, L_7, /*hidden argument*/NULL);
- NullCheck(L_5);
- RuntimeObject * L_9 = ObjectTranslator_GetObject_m805173647(L_5, L_6, 2, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- RuntimeObject * L_10 = V_2;
- bool L_11 = Vector2_Equals_m832062989((&V_1), L_10, /*hidden argument*/NULL);
- V_3 = L_11;
- intptr_t L_12 = ___L0;
- bool L_13 = V_3;
- Lua_lua_pushboolean_m2404392622(NULL /*static, unused*/, L_12, L_13, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_14 = V_0;
- intptr_t L_15 = ___L0;
- Vector2_t2156229523 L_16 = V_1;
- NullCheck(L_14);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_14, L_15, 1, L_16, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_006b;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0050;
- throw e;
- }
- CATCH_0050:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_17 = ___L0;
- Exception_t * L_18 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_19 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_18, /*hidden argument*/NULL);
- int32_t L_20 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_17, L_19, /*hidden argument*/NULL);
- V_4 = L_20;
- goto IL_006b;
- } // end catch (depth: 1)
- IL_006b:
- {
- int32_t L_21 = V_4;
- return L_21;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Reflect_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Reflect_xlua_st__m2288796039_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_9 = Vector2_Reflect_m4187417778(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- Vector2_t2156229523 L_12 = V_3;
- NullCheck(L_10);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Dot_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Dot_xlua_st__m2208651729_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- float L_9 = Vector2_Dot_m1554553447(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- intptr_t L_10 = ___L0;
- float L_11 = V_3;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_10, (((double)((double)L_11))), /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_4 = L_15;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_16 = V_4;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Angle_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Angle_xlua_st__m344236503_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- float L_9 = Vector2_Angle_m4105581454(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- intptr_t L_10 = ___L0;
- float L_11 = V_3;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_10, (((double)((double)L_11))), /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_4 = L_15;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_16 = V_4;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SignedAngle_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_SignedAngle_xlua_st__m4239870774_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- float L_9 = Vector2_SignedAngle_m1664554214(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- intptr_t L_10 = ___L0;
- float L_11 = V_3;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_10, (((double)((double)L_11))), /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_4 = L_15;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_16 = V_4;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Distance_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Distance_xlua_st__m490608416_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- float V_3 = 0.0f;
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- float L_9 = Vector2_Distance_m3048868881(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- intptr_t L_10 = ___L0;
- float L_11 = V_3;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_10, (((double)((double)L_11))), /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_12 = ___L0;
- Exception_t * L_13 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_14 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_13, /*hidden argument*/NULL);
- int32_t L_15 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_12, L_14, /*hidden argument*/NULL);
- V_4 = L_15;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_16 = V_4;
- return L_16;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_ClampMagnitude_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_ClampMagnitude_xlua_st__m2828521828_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- float V_2 = 0.0f;
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- double L_6 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_5, 2, /*hidden argument*/NULL);
- V_2 = (((float)((float)L_6)));
- Vector2_t2156229523 L_7 = V_1;
- float L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_9 = Vector2_ClampMagnitude_m1438220061(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- Vector2_t2156229523 L_12 = V_3;
- NullCheck(L_10);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0052;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0037;
- throw e;
- }
- CATCH_0037:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0052;
- } // end catch (depth: 1)
- IL_0052:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SqrMagnitude_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_SqrMagnitude_xlua_st__m2268041442_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- float V_2 = 0.0f;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- Vector2_t2156229523 L_5 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- float L_6 = Vector2_SqrMagnitude_m2414967581(NULL /*static, unused*/, L_5, /*hidden argument*/NULL);
- V_2 = L_6;
- intptr_t L_7 = ___L0;
- float L_8 = V_2;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_7, (((double)((double)L_8))), /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0046;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_002c;
- throw e;
- }
- CATCH_002c:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_9 = ___L0;
- Exception_t * L_10 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_11 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_10, /*hidden argument*/NULL);
- int32_t L_12 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_9, L_11, /*hidden argument*/NULL);
- V_3 = L_12;
- goto IL_0046;
- } // end catch (depth: 1)
- IL_0046:
- {
- int32_t L_13 = V_3;
- return L_13;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SqrMagnitude(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_SqrMagnitude_m4112112203_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- float V_2 = 0.0f;
- int32_t V_3 = 0;
- Exception_t * V_4 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- float L_5 = Vector2_SqrMagnitude_m2507415696((&V_1), /*hidden argument*/NULL);
- V_2 = L_5;
- intptr_t L_6 = ___L0;
- float L_7 = V_2;
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_6, (((double)((double)L_7))), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_8 = V_0;
- intptr_t L_9 = ___L0;
- Vector2_t2156229523 L_10 = V_1;
- NullCheck(L_8);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_8, L_9, 1, L_10, /*hidden argument*/NULL);
- V_3 = 1;
- goto IL_0050;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0036;
- throw e;
- }
- CATCH_0036:
- { // begin catch(System.Exception)
- V_4 = ((Exception_t *)__exception_local);
- intptr_t L_11 = ___L0;
- Exception_t * L_12 = V_4;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_13 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_12, /*hidden argument*/NULL);
- int32_t L_14 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_11, L_13, /*hidden argument*/NULL);
- V_3 = L_14;
- goto IL_0050;
- } // end catch (depth: 1)
- IL_0050:
- {
- int32_t L_15 = V_3;
- return L_15;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Min_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Min_xlua_st__m1691422761_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_9 = Vector2_Min_m1808913837(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- Vector2_t2156229523 L_12 = V_3;
- NullCheck(L_10);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_Max_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_Max_xlua_st__m3286595310_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- int32_t V_4 = 0;
- Exception_t * V_5 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- Vector2_t2156229523 L_7 = V_1;
- Vector2_t2156229523 L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_9 = Vector2_Max_m2539715210(NULL /*static, unused*/, L_7, L_8, /*hidden argument*/NULL);
- V_3 = L_9;
- ObjectTranslator_t2020767555 * L_10 = V_0;
- intptr_t L_11 = ___L0;
- Vector2_t2156229523 L_12 = V_3;
- NullCheck(L_10);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_10, L_11, L_12, /*hidden argument*/NULL);
- V_4 = 1;
- goto IL_0053;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0038;
- throw e;
- }
- CATCH_0038:
- { // begin catch(System.Exception)
- V_5 = ((Exception_t *)__exception_local);
- intptr_t L_13 = ___L0;
- Exception_t * L_14 = V_5;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_15 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_14, /*hidden argument*/NULL);
- int32_t L_16 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_13, L_15, /*hidden argument*/NULL);
- V_4 = L_16;
- goto IL_0053;
- } // end catch (depth: 1)
- IL_0053:
- {
- int32_t L_17 = V_4;
- return L_17;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_m_SmoothDamp_xlua_st_(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__m_SmoothDamp_xlua_st__m3152138514_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Vector2_t2156229523 V_2;
- memset(&V_2, 0, sizeof(V_2));
- Vector2_t2156229523 V_3;
- memset(&V_3, 0, sizeof(V_3));
- float V_4 = 0.0f;
- float V_5 = 0.0f;
- float V_6 = 0.0f;
- Vector2_t2156229523 V_7;
- memset(&V_7, 0, sizeof(V_7));
- int32_t V_8 = 0;
- Exception_t * V_9 = NULL;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- NullCheck(L_5);
- ObjectTranslator_Get_m1627229422(L_5, L_6, 2, (&V_2), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- NullCheck(L_7);
- ObjectTranslator_Get_m1627229422(L_7, L_8, 3, (&V_3), /*hidden argument*/NULL);
- intptr_t L_9 = ___L0;
- double L_10 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_9, 4, /*hidden argument*/NULL);
- V_4 = (((float)((float)L_10)));
- intptr_t L_11 = ___L0;
- double L_12 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_11, 5, /*hidden argument*/NULL);
- V_5 = (((float)((float)L_12)));
- intptr_t L_13 = ___L0;
- double L_14 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_13, 6, /*hidden argument*/NULL);
- V_6 = (((float)((float)L_14)));
- Vector2_t2156229523 L_15 = V_1;
- Vector2_t2156229523 L_16 = V_2;
- float L_17 = V_4;
- float L_18 = V_5;
- float L_19 = V_6;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_20 = Vector2_SmoothDamp_m1183918543(NULL /*static, unused*/, L_15, L_16, (&V_3), L_17, L_18, L_19, /*hidden argument*/NULL);
- V_7 = L_20;
- ObjectTranslator_t2020767555 * L_21 = V_0;
- intptr_t L_22 = ___L0;
- Vector2_t2156229523 L_23 = V_7;
- NullCheck(L_21);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_21, L_22, L_23, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_24 = V_0;
- intptr_t L_25 = ___L0;
- Vector2_t2156229523 L_26 = V_3;
- NullCheck(L_24);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_24, L_25, L_26, /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_27 = V_0;
- intptr_t L_28 = ___L0;
- Vector2_t2156229523 L_29 = V_3;
- NullCheck(L_27);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_27, L_28, 3, L_29, /*hidden argument*/NULL);
- V_8 = 2;
- goto IL_0096;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_007b;
- throw e;
- }
- CATCH_007b:
- { // begin catch(System.Exception)
- V_9 = ((Exception_t *)__exception_local);
- intptr_t L_30 = ___L0;
- Exception_t * L_31 = V_9;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_32 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_31, /*hidden argument*/NULL);
- int32_t L_33 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_30, L_32, /*hidden argument*/NULL);
- V_8 = L_33;
- goto IL_0096;
- } // end catch (depth: 1)
- IL_0096:
- {
- int32_t L_34 = V_8;
- return L_34;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_normalized(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_normalized_m1526536551 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_normalized_m1526536551_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- ObjectTranslator_t2020767555 * L_5 = V_0;
- intptr_t L_6 = ___L0;
- Vector2_t2156229523 L_7 = Vector2_get_normalized_m2683665860((&V_1), /*hidden argument*/NULL);
- NullCheck(L_5);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_5, L_6, L_7, /*hidden argument*/NULL);
- goto IL_0041;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0029;
- throw e;
- }
- CATCH_0029:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_8 = ___L0;
- Exception_t * L_9 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_10 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_9, /*hidden argument*/NULL);
- int32_t L_11 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_8, L_10, /*hidden argument*/NULL);
- V_3 = L_11;
- goto IL_0043;
- } // end catch (depth: 1)
- IL_0041:
- {
- return 1;
- }
- IL_0043:
- {
- int32_t L_12 = V_3;
- return L_12;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_magnitude(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_magnitude_m1920742942 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_magnitude_m1920742942_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- float L_6 = Vector2_get_magnitude_m2752892833((&V_1), /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_5, (((double)((double)L_6))), /*hidden argument*/NULL);
- goto IL_0041;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0029;
- throw e;
- }
- CATCH_0029:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- goto IL_0043;
- } // end catch (depth: 1)
- IL_0041:
- {
- return 1;
- }
- IL_0043:
- {
- int32_t L_11 = V_3;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_sqrMagnitude(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_sqrMagnitude_m1792890676_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- float L_6 = Vector2_get_sqrMagnitude_m837837635((&V_1), /*hidden argument*/NULL);
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_5, (((double)((double)L_6))), /*hidden argument*/NULL);
- goto IL_0041;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0029;
- throw e;
- }
- CATCH_0029:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- goto IL_0043;
- } // end catch (depth: 1)
- IL_0041:
- {
- return 1;
- }
- IL_0043:
- {
- int32_t L_11 = V_3;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_zero(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_zero_m4234870038 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_zero_m4234870038_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_zero_m540426400(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_one(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_one_m1876688525 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_one_m1876688525_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_one_m738793577(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_up(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_up_m2923378165 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_up_m2923378165_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_up_m2647420593(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_down(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_down_m2946352740 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_down_m2946352740_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_down_m2886001705(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_left(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_left_m158211399 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_left_m158211399_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_left_m1559018038(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_right(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_right_m77832184 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_right_m77832184_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_right_m1027081661(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_positiveInfinity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_positiveInfinity_m566707909_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_positiveInfinity_m1229371315(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_negativeInfinity(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_negativeInfinity_m2745521575_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Exception_t * V_1 = NULL;
- int32_t V_2 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- IL2CPP_RUNTIME_CLASS_INIT(Vector2_t2156229523_il2cpp_TypeInfo_var);
- Vector2_t2156229523 L_5 = Vector2_get_negativeInfinity_m1601170781(NULL /*static, unused*/, /*hidden argument*/NULL);
- NullCheck(L_3);
- ObjectTranslator_PushUnityEngineVector2_m3232111227(L_3, L_4, L_5, /*hidden argument*/NULL);
- goto IL_0035;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_001d;
- throw e;
- }
- CATCH_001d:
- { // begin catch(System.Exception)
- V_1 = ((Exception_t *)__exception_local);
- intptr_t L_6 = ___L0;
- Exception_t * L_7 = V_1;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_8 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_7, /*hidden argument*/NULL);
- int32_t L_9 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_6, L_8, /*hidden argument*/NULL);
- V_2 = L_9;
- goto IL_0037;
- } // end catch (depth: 1)
- IL_0035:
- {
- return 1;
- }
- IL_0037:
- {
- int32_t L_10 = V_2;
- return L_10;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_x(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_x_m4147433016 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_x_m4147433016_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- float L_6 = (&V_1)->get_x_0();
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_5, (((double)((double)L_6))), /*hidden argument*/NULL);
- goto IL_0041;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0029;
- throw e;
- }
- CATCH_0029:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- goto IL_0043;
- } // end catch (depth: 1)
- IL_0041:
- {
- return 1;
- }
- IL_0043:
- {
- int32_t L_11 = V_3;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_g_get_y(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__g_get_y_m2714693255 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__g_get_y_m2714693255_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- float L_6 = (&V_1)->get_y_1();
- Lua_lua_pushnumber_m3190857213(NULL /*static, unused*/, L_5, (((double)((double)L_6))), /*hidden argument*/NULL);
- goto IL_0041;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0029;
- throw e;
- }
- CATCH_0029:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_7 = ___L0;
- Exception_t * L_8 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_9 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_8, /*hidden argument*/NULL);
- int32_t L_10 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_7, L_9, /*hidden argument*/NULL);
- V_3 = L_10;
- goto IL_0043;
- } // end catch (depth: 1)
- IL_0041:
- {
- return 1;
- }
- IL_0043:
- {
- int32_t L_11 = V_3;
- return L_11;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_s_set_x(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__s_set_x_m2341483890 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__s_set_x_m2341483890_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- double L_6 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_5, 2, /*hidden argument*/NULL);
- (&V_1)->set_x_0((((float)((float)L_6))));
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- Vector2_t2156229523 L_9 = V_1;
- NullCheck(L_7);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_7, L_8, 1, L_9, /*hidden argument*/NULL);
- goto IL_004b;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0033;
- throw e;
- }
- CATCH_0033:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_004d;
- } // end catch (depth: 1)
- IL_004b:
- {
- return 0;
- }
- IL_004d:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- // System.Int32 XLua.CSObjectWrap.UnityEngineVector2Wrap::_s_set_y(System.IntPtr)
- extern "C" IL2CPP_METHOD_ATTR int32_t UnityEngineVector2Wrap__s_set_y_m3798992961 (RuntimeObject * __this /* static, unused */, intptr_t ___L0, const RuntimeMethod* method)
- {
- static bool s_Il2CppMethodInitialized;
- if (!s_Il2CppMethodInitialized)
- {
- il2cpp_codegen_initialize_method (UnityEngineVector2Wrap__s_set_y_m3798992961_MetadataUsageId);
- s_Il2CppMethodInitialized = true;
- }
- ObjectTranslator_t2020767555 * V_0 = NULL;
- Vector2_t2156229523 V_1;
- memset(&V_1, 0, sizeof(V_1));
- Exception_t * V_2 = NULL;
- int32_t V_3 = 0;
- Exception_t * __last_unhandled_exception = 0;
- NO_UNUSED_WARNING (__last_unhandled_exception);
- Exception_t * __exception_local = 0;
- NO_UNUSED_WARNING (__exception_local);
- int32_t __leave_target = 0;
- NO_UNUSED_WARNING (__leave_target);
- IL_0000:
- try
- { // begin try (depth: 1)
- ObjectTranslatorPool_t158158286 * L_0 = ObjectTranslatorPool_get_Instance_m842665354(NULL /*static, unused*/, /*hidden argument*/NULL);
- intptr_t L_1 = ___L0;
- NullCheck(L_0);
- ObjectTranslator_t2020767555 * L_2 = ObjectTranslatorPool_Find_m2808149378(L_0, L_1, /*hidden argument*/NULL);
- V_0 = L_2;
- ObjectTranslator_t2020767555 * L_3 = V_0;
- intptr_t L_4 = ___L0;
- NullCheck(L_3);
- ObjectTranslator_Get_m1627229422(L_3, L_4, 1, (&V_1), /*hidden argument*/NULL);
- intptr_t L_5 = ___L0;
- double L_6 = Lua_lua_tonumber_m3087017991(NULL /*static, unused*/, L_5, 2, /*hidden argument*/NULL);
- (&V_1)->set_y_1((((float)((float)L_6))));
- ObjectTranslator_t2020767555 * L_7 = V_0;
- intptr_t L_8 = ___L0;
- Vector2_t2156229523 L_9 = V_1;
- NullCheck(L_7);
- ObjectTranslator_UpdateUnityEngineVector2_m2314138213(L_7, L_8, 1, L_9, /*hidden argument*/NULL);
- goto IL_004b;
- } // end try (depth: 1)
- catch(Il2CppExceptionWrapper& e)
- {
- __exception_local = (Exception_t *)e.ex;
- if(il2cpp_codegen_class_is_assignable_from (Exception_t_il2cpp_TypeInfo_var, il2cpp_codegen_object_class(e.ex)))
- goto CATCH_0033;
- throw e;
- }
- CATCH_0033:
- { // begin catch(System.Exception)
- V_2 = ((Exception_t *)__exception_local);
- intptr_t L_10 = ___L0;
- Exception_t * L_11 = V_2;
- IL2CPP_RUNTIME_CLASS_INIT(String_t_il2cpp_TypeInfo_var);
- String_t* L_12 = String_Concat_m904156431(NULL /*static, unused*/, _stringLiteral632665612, L_11, /*hidden argument*/NULL);
- int32_t L_13 = Lua_luaL_error_m1118924357(NULL /*static, unused*/, L_10, L_12, /*hidden argument*/NULL);
- V_3 = L_13;
- goto IL_004d;
- } // end catch (depth: 1)
- IL_004b:
- {
- return 0;
- }
- IL_004d:
- {
- int32_t L_14 = V_3;
- return L_14;
- }
- }
- #ifdef __clang__
- #pragma clang diagnostic pop
- #endif
|
